查看完整 summary.json 原文
{
"code": "SASDF98",
"status": "Published",
"type_of_curve": "Extrapolated to infinite dilution",
"angular_unit": "1/nm",
"project": {
"title": "Quantitative Conformational Analysis of Functionally Important Electrostatic Interactions in the Intrinsically Disordered Region of Delta Subunit of Bacterial RNA Polymerase.",
"publication": {
"title": "Quantitative Conformational Analysis of Functionally Important Electrostatic Interactions in the Intrinsically Disordered Region of Delta Subunit of Bacterial RNA Polymerase.",
"author_list": "Kuban V, Srb P, Stegnerova H, Padrta P, Zachrdla M, Jasenakova Z, Šanderová H, Vítovská D, Krasny L, Koval T, Dohnalek J, Ziemska-Legi Cka J, Grynberg M, Jarnot P, Gruca A, Jensen MR, Blackledge M, Zidek L",
"journal": "J Am Chem Soc",
"doi": "10.1021/jacs.9b07837",
"pmid": "31550880",
"published_date": "2019 Sep 24"
},
"status": "released",
"submitted_date": "2019-06-22",
"released_date": "2019-09-30"
},
"pddf_data": null,
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDF98.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDF98_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDF98_kratky_img.png",
"pddf_plot": null,
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDF98_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDF98.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Pilatus 2M",
"resolution": null
},
"name": "PETRA III",
"city": "DESY; Hamburg",
"country": "Germany",
"beamline_name": "EMBL P12",
"beam_geometry": null,
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "DNA-directed RNA polymerase subunit delta - mutant",
"short_name": "rpoE KE mutant",
"sequence": "MGIKQYSQEELKEMALVEIAHELFEEHKKPVPFQELLNEIASLLGVKKEELGDRIAQFYTDLNIDGRFLALSDQTWGLRSWYPYDQLDEETQPTVEAEEEEAEEAVEEDLDLDEFEEIDEDDLDLDEVEEELDLEADDFDEEDLDEDDDDLEIEEDIIDEDDEDYDDEEEEIK",
"organism": "Bacillus subtilis",
"uniprot_code": "P12464",
"uniprot_range_first": 1,
"uniprot_range_last": 173,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MGIKQYSQEELKEMALVEIAHELFEEHKKPVPFQELLNEIASLLGVKKEELGDRIAQFYT\nDLNIDGRFLALSDQTWGLRSWYPYDQLDEETQPTVKAKKKKAKKAVEEDLDLDEFEEIDE\nDDLDLDEVEEELDLEADDFDEEDLDEDDDDLEIEEDIIDEDDEDYDDEEEEIK",
"mw": 20.405,
"total_mw": 20.405,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "20 mM Phosphate buffer, 10 mM NaCl, 0.05% NaN3",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 6.6,
"deuteration": null
},
"purity_method": null,
"name": "Delta subunit of RNA polymerase, RNAP (B. subtilis): Lysine to glutamate mutant, 10mM NaCl",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": "MUNI",
"address": "Brno, Czech Republic",
"full_name": "Masaryk University; \tResearch group Structure and Dynamics of Proteins.",
"webpage": "https://www.muni.cz/"
}
],
"contributor_name": "Vojtěch",
"contributor_surname": "Kubáň",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2016-10-03",
"storage_temperature": 20.0,
"cell_temperature": 20.0,
"exposure_time": 0.05,
"number_of_frames": 20,
"wavelength": 0.124,
"sample_detector_distance": 3.0,
"concentration_min": 0.8,
"concentration_max": 2.6,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.013,
"s_max": 3.792,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [],
"estimated_volume_method": null,
"pddf_software": null,
"pddf_software_version": null,
"i0_calibration_standard": null,
"description": "There is a concentration effect in the concentration series for the sample in 10 mM salt buffer, so we use extrapolation to infinite dilution.",
"experiment_description": "Synchrotron SAXS data from solutions of Lys-Glu mutant RNAP in 20 mM phosphate buffer, 10 mM NaCl, 0.05% NaN3, pH 6.6 were collected on the EMBL P12 beam line at PETRA III (Hamburg, Germany) using a Pilatus 2M detector at a sample-detector distance of 3 m and at a wavelength of λ = 0.124 nm (I(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). Solute concentrations ranging between 0.8 and 2.6 mg/ml were measured at 20°C. 20 successive 0.050 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted. The low angle data collected at lower concentrations were extrapolated to infinite dilution and merged with the higher concentration data to yield the final composite scattering curve.",
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 23.0,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 36.0,
"porod_mw_error": null,
"pddf_i0": null,
"pddf_i0_error": null,
"guinier_i0": 4905.0,
"guinier_i0_error": 49.0,
"pddf_rg": null,
"pddf_rg_error": null,
"guinier_rg": 4.29,
"guinier_rg_error": 0.6,
"pddf_dmax": 19.5,
"pddf_dmax_error": null,
"porod_volume": 58.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 21,
"guinier_point_last": 139,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDF98_datloglog_img.png",
"symmetry": null,
"last_modified": "2023-06-21T07:56:39.492710+02:00",
"bragg_peak": []
}查看完整 manifest.json 原文
{
"code": "SASDF98",
"status": "success",
"started_at": "2026-08-11T15:48:22.137685+00:00",
"finished_at": "2026-08-11T15:48:28.951753+00:00",
"source_last_modified": "2023-06-21T07:56:39.492710+02:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDF98/",
"path": "/data/saxsdb/sasbdb/entries/98/sasdf98/source/summary.json",
"size": 6819,
"sha256": "e9e0b3effd923656f699d36c7657457557020290c7b30f1853bed49364a39300"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDF98.dat",
"path": "/data/saxsdb/sasbdb/entries/98/sasdf98/source/SASDF98.dat",
"size": 82030,
"sha256": "4589f93c255a1153eedfc98205f861cb81c7bbd4d538413c60a50b42442be016",
"role": "curve"
},
{
"role": "pddf",
"status": "not_listed",
"path": "/data/saxsdb/sasbdb/entries/98/sasdf98/source/SASDF98.out"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDF98.sascif",
"path": "/data/saxsdb/sasbdb/entries/98/sasdf98/source/SASDF98.sascif",
"size": 105708,
"sha256": "adf934c5599583248b9c4675d7f63fff8ebfe32d2169bf34e9e1ee0f2aa16692",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDF98.zip",
"path": "/data/saxsdb/sasbdb/entries/98/sasdf98/source/SASDF98.zip",
"size": 24354,
"sha256": "423bf5128a7ba12a4b411191eb06dd4b6dd2a149afb44bb1a17ca871ff950806",
"role": "full_entry_zip",
"zip_member_count": 1,
"zip_validation": "central_directory_readable"
}
]
}
