The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDFA8",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/nm",
"project": {
"title": "Quantitative Conformational Analysis of Functionally Important Electrostatic Interactions in the Intrinsically Disordered Region of Delta Subunit of Bacterial RNA Polymerase.",
"publication": {
"title": "Quantitative Conformational Analysis of Functionally Important Electrostatic Interactions in the Intrinsically Disordered Region of Delta Subunit of Bacterial RNA Polymerase.",
"author_list": "Kuban V, Srb P, Stegnerova H, Padrta P, Zachrdla M, Jasenakova Z, Šanderová H, Vítovská D, Krasny L, Koval T, Dohnalek J, Ziemska-Legi Cka J, Grynberg M, Jarnot P, Gruca A, Jensen MR, Blackledge M, Zidek L",
"journal": "J Am Chem Soc",
"doi": "10.1021/jacs.9b07837",
"pmid": "31550880",
"published_date": "2019 Sep 24"
},
"status": "released",
"submitted_date": "2019-06-22",
"released_date": "2019-09-30"
},
"pddf_data": null,
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDFA8.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDFA8_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDFA8_kratky_img.png",
"pddf_plot": null,
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDFA8_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDFA8.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Pilatus 2M",
"resolution": null
},
"name": "PETRA III",
"city": "DESY; Hamburg",
"country": "Germany",
"beamline_name": "EMBL P12",
"beam_geometry": null,
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "DNA-directed RNA polymerase subunit delta - mutant",
"short_name": "rpoE KE mutant",
"sequence": "MGIKQYSQEELKEMALVEIAHELFEEHKKPVPFQELLNEIASLLGVKKEELGDRIAQFYTDLNIDGRFLALSDQTWGLRSWYPYDQLDEETQPTVEAEEEEAEEAVEEDLDLDEFEEIDEDDLDLDEVEEELDLEADDFDEEDLDEDDDDLEIEEDIIDEDDEDYDDEEEEIK",
"organism": "Bacillus subtilis",
"uniprot_code": "P12464",
"uniprot_range_first": 1,
"uniprot_range_last": 173,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MGIKQYSQEELKEMALVEIAHELFEEHKKPVPFQELLNEIASLLGVKKEELGDRIAQFYT\nDLNIDGRFLALSDQTWGLRSWYPYDQLDEETQPTVKAKKKKAKKAVEEDLDLDEFEEIDE\nDDLDLDEVEEELDLEADDFDEEDLDEDDDDLEIEEDIIDEDDEDYDDEEEEIK",
"mw": 20.405,
"total_mw": 20.405,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "20 mM Phosphate buffer, 200 mM NaCl, 0.05% NaN3",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 6.6,
"deuteration": null
},
"purity_method": null,
"name": "Delta subunit of RNA polymerase, RNAP (B. subtilis): Lysine to glutamate mutant, 200mM NaCl",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": "MUNI",
"address": "Brno, Czech Republic",
"full_name": "Masaryk University; \tResearch group Structure and Dynamics of Proteins.",
"webpage": "https://www.muni.cz/"
}
],
"contributor_name": "Vojtěch",
"contributor_surname": "Kubáň",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2016-10-03",
"storage_temperature": 20.0,
"cell_temperature": 20.0,
"exposure_time": 0.05,
"number_of_frames": 20,
"wavelength": 0.124,
"sample_detector_distance": 3.0,
"concentration_min": null,
"concentration_max": 2.6,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.013,
"s_max": 3.79,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [],
"estimated_volume_method": null,
"pddf_software": null,
"pddf_software_version": null,
"i0_calibration_standard": null,
"description": null,
"experiment_description": "Synchrotron SAXS data from solutions of Lys-Glu mutant RNAP in 20 mM phosphate buffer, 200 mM NaCl, 0.05% NaN3, pH 6.6 were collected on the EMBL P12 beam line at PETRA III (Hamburg, Germany) using a Pilatus 2M detector at a sample-detector distance of 3 m and at a wavelength of λ = 0.124 nm (I(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). One solute concentration of 2.60 mg/ml was measured at 20°C. 20 successive 0.050 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 42.8,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 47.0,
"porod_mw_error": null,
"pddf_i0": null,
"pddf_i0_error": null,
"guinier_i0": 1716.6,
"guinier_i0_error": 8.0,
"pddf_rg": null,
"pddf_rg_error": null,
"guinier_rg": 4.61,
"guinier_rg_error": 0.6,
"pddf_dmax": 22.0,
"pddf_dmax_error": null,
"porod_volume": 76.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 27,
"guinier_point_last": 129,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDFA8_datloglog_img.png",
"symmetry": null,
"last_modified": "2023-06-21T07:56:39.492710+02:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDFA8",
"status": "success",
"started_at": "2026-08-11T15:48:56.775496+00:00",
"finished_at": "2026-08-11T15:49:04.215892+00:00",
"source_last_modified": "2023-06-21T07:56:39.492710+02:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDFA8/",
"path": "/data/saxsdb/sasbdb/entries/a8/sasdfa8/source/summary.json",
"size": 6465,
"sha256": "020d0f7f8bfdffc95788cb2bca28368e1aaa55a6b5115bc33ef582d22230662c"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDFA8.dat",
"path": "/data/saxsdb/sasbdb/entries/a8/sasdfa8/source/SASDFA8.dat",
"size": 82991,
"sha256": "9e74494bdf77d8367cd9616beb681ecfe53c8d7ce52c63094e2cf8405ccf8fd7",
"role": "curve"
},
{
"role": "pddf",
"status": "not_listed",
"path": "/data/saxsdb/sasbdb/entries/a8/sasdfa8/source/SASDFA8.out"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDFA8.sascif",
"path": "/data/saxsdb/sasbdb/entries/a8/sasdfa8/source/SASDFA8.sascif",
"size": 105506,
"sha256": "3b464912e6edf3132e2317edfd459054c8225973a9ce0a962ba184d73febe24c",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDFA8.zip",
"path": "/data/saxsdb/sasbdb/entries/a8/sasdfa8/source/SASDFA8.zip",
"size": 24359,
"sha256": "af2c4740fb73c43e918bc6b8114c995eb6056009c010c094f701e1c96a21c861",
"role": "full_entry_zip",
"zip_member_count": 1,
"zip_validation": "central_directory_readable"
}
]
}
