The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDFL4",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/A",
"project": {
"title": "Solution structure, glycan specificity and of phenol oxidase inhibitory activity of Anopheles C-type lectins CTL4 and CTLMA2.",
"publication": {
"title": "Solution structure, glycan specificity and of phenol oxidase inhibitory activity of Anopheles C-type lectins CTL4 and CTLMA2.",
"author_list": "Bishnoi R, Sousa GL, Contet A, Day CJ, Hou CD, Profitt LA, Singla D, Jennings MP, Valentine AM, Povelones M, Baxter RHG",
"journal": "Sci Rep",
"doi": "10.1038/s41598-019-51353-z",
"pmid": "31645596",
"published_date": "2019 Oct 23"
},
"status": "released",
"submitted_date": "2019-03-25",
"released_date": "2019-04-08"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDFL4.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDFL4.txt",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDFL4_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDFL4_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDFL4_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDFL4_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDFL4.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Pilatus 100K",
"resolution": 172.0
},
"name": "Thomas Jefferson University",
"city": "Philadelphia, PA",
"country": "USA",
"beamline_name": "Rigaku BioSAXS-2000",
"beam_geometry": null,
"type_of_source": "X-ray in house",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "AGAP005335-PA",
"short_name": "CTL4",
"sequence": "YRATTAREMITQNLCVCPCGNPRGGKLYTTPNLRLN\r\nWFDAVSYCSSIGMSIATIKDTNERQLLQLHLDGDRRLTRSQKRSKIPYWIGANSLIAGQG\r\nLRWGLTDQEVKESAEWADGIAPANNRVEPFCVYIQGSTMSWVATSCDDEPRQFICEYHHHHHH",
"organism": "Anopheles gambiae",
"uniprot_code": "Q7Q7F7",
"uniprot_range_first": 25,
"uniprot_range_last": 177,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MQISNIFVSSIGITLVCLIVSTHGYRATTAREMITQNLCVCPCGNPRGGKLYTTPNLRLN\nWFDAVSYCSSIGMSIATIKDTNERQLLQLHLDGDRRLTRSQKRSKIPYWIGANSLIAGQG\nLRWGLTDQEVKESAEWADGIAPANNRVEPFCVYIQGSTMSWVATSCDDEPRQFICEY",
"mw": 18.095,
"total_mw": 18.095,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
},
{
"long_name": "AGAP005334-PA",
"short_name": "CTLMA2",
"sequence": "DLSVPKTVDDILQQNPCLCPCKPFEEKEYFIPISRTSDWFGAV\r\nAYCHSVGMELAEVLNEDEARAMGEVIAEEESDSDDEFYWIGANDLGVQGTYRWALAGRPV\r\nLYSQWAAGEPNHARGENGQQPAERCVAVAMDKYEWNDFQCTQQKPFICQQFRKH",
"organism": "Anopheles gambiae",
"uniprot_code": "Q7Q7F8",
"uniprot_range_first": 18,
"uniprot_range_last": 174,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MNLMITILIAVITVVRGDLSVPKTVDDILQQNPCLCPCKPFEEKEYFIPISRTSDWFGAV\nAYCHSVGMELAEVLNEDEARAMGEVIAEEESDSDDEFYWIGANDLGVQGTYRWALAGRPV\nLYSQWAAGEPNHARGENGQQPAERCVAVAMDKYEWNDFQCTQQKPFICQQFRKH",
"mw": 17.874,
"total_mw": 17.874,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "500 mM NaCl, 20 mM CHES, 0.5 mM CaCl2, 1% glycerol",
"concentration_unit": null,
"comment": "necessary to prevent formation of higher order oligomers",
"additive": null,
"concentration": null,
"pka": null,
"ph": 9.0,
"deuteration": null
},
"purity_method": null,
"name": "C-type lectins CTL4/CTLMA2, 3.1 mg/ml",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": "Philadelphia, USA",
"full_name": "Temple University",
"webpage": "https://www.temple.edu/"
}
],
"contributor_name": "Richard",
"contributor_surname": "Baxter",
"orcid": "https://orcid.org/0000-0001-5140-1726"
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2018-08-30",
"storage_temperature": 20.0,
"cell_temperature": 20.0,
"exposure_time": 300.0,
"number_of_frames": 6,
"wavelength": 0.154187,
"sample_detector_distance": 0.481,
"concentration_min": null,
"concentration_max": 3.1,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.066,
"s_max": 6.94,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDFL4_fit1_model1_img.png",
"software": "MultiFoXS",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDFL4_fit1_model1.pdb",
"model_mw": 35.95,
"bead_radius": null,
"log": null,
"symmetry": null,
"comment": null,
"user": 424
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDFL4_fit1_model2_img.png",
"software": "MultiFoXS",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDFL4_fit1_model2.pdb",
"model_mw": 35.95,
"bead_radius": null,
"log": null,
"symmetry": null,
"comment": null,
"user": 424
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDFL4_fit1_model3_img.png",
"software": "MultiFoXS",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDFL4_fit1_model3.pdb",
"model_mw": 35.95,
"bead_radius": null,
"log": null,
"symmetry": null,
"comment": null,
"user": 424
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/multi_state_model_3_1_1_fitfoxs_img.png",
"software": "MultiFoXS",
"chi_square_value": 1.072759,
"p_value": 0.481779,
"fit_residual_plot": "multi_state_model_3_1_1_fitfoxsresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDFL4_fit1.dat",
"fit_log": null,
"software_version": null,
"description": ""
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "4.6",
"i0_calibration_standard": null,
"description": null,
"experiment_description": "SAXS data from solutions of C-type lectins CTL4/CTLMA2 in 500 mM NaCl, 20 mM CHES, 0.5 mM CaCl2, 1% glycerol, pH 9 were collected on a Rigaku BioSAXS-2000 instrument at Thomas Jefferson University (Philadelphia, PA, USA) using a Pilatus 100K detector at a sample-detector distance of 0.481 m and at a wavelength of λ = 0.154187 nm (l(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). One solute concentration of 3.10 mg/ml was measured at 20°C. Six successive 300 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 39.0,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 36.0,
"porod_mw_error": null,
"pddf_i0": 0.6474,
"pddf_i0_error": null,
"guinier_i0": 0.65,
"guinier_i0_error": 0.01,
"pddf_rg": 2.54,
"pddf_rg_error": null,
"guinier_rg": 2.49,
"guinier_rg_error": 0.03,
"pddf_dmax": 8.0,
"pddf_dmax_error": null,
"porod_volume": 58.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 9,
"guinier_point_last": 32,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDFL4_datloglog_img.png",
"symmetry": null,
"last_modified": "2025-03-18T10:29:02.995592+01:00",
"bragg_peak": []
}
