The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDFL6",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/nm",
"project": {
"title": "Tetramerization at low pH licenses DNA methylation activity of M.HpyAXI in the presence of acid stress.",
"publication": {
"title": "Tetramerization at low pH licenses DNA methylation activity of M.HpyAXI in the presence of acid stress.",
"author_list": "Narayanan N, Banerjee A, Jain D, Kulkarni DS, Sharma R, Nirwal S, Rao DN, Nair DT",
"journal": "J Mol Biol",
"doi": "10.1016/j.jmb.2019.10.001",
"pmid": "31628946",
"published_date": "2019 Oct 16"
},
"status": "released",
"submitted_date": "2019-05-31",
"released_date": "2019-11-17"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDFL6.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDFL6.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDFL6_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDFL6_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDFL6_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDFL6_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDFL6.sascif",
"experiment": {
"instrument": {
"detector": {
"type": "Dectris",
"name": "Pilatus 1M",
"resolution": 172.0
},
"name": "ESRF",
"city": "Grenoble",
"country": "France",
"beamline_name": "ID14-3",
"beam_geometry": "",
"type_of_source": "X-ray synchrotron",
"point_source": true,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Adenine specific DNA methyltransferase (Mod)",
"short_name": null,
"sequence": ">tr|O25315|O25315_HELPY Adenine specific DNA methyltransferase (Mod) OS=Helicobacter pylori (strain ATCC 700392 / 26695) OX=85962 GN=HP_0593 PE=4 SV=1\r\nMLLKNFPQTIKDGQVSLSAIKMLLGFNESMNDISGYELTWTGKGFANALYSEPCQKQLKL\r\nQESFTPQTSASKHPNNAIIIGDNLDALKLLKSAYSEKIKMIYIDPPYNTGNDEFIYPDNF\r\nRQDYQKILREVGLMEIDENGKEIESESLKFFKNTQGSGTHSGWLSFMLPRLKLARDLLKE\r\nDGVIFISIDDNECANLKILCDEIFGEDNFVGDFIRKTKSTTNDAKIGLNYQHEFLLCYAK\r\nDKNYTNLLGGEKNLENYKNPDNDPNGAWINDNPSAKSGNMKTGYFGVTNPYTNKVDYPPV\r\nGMFWRFSQNTIQKHIDEGRICFKKEHKDNERGFIYKRYLKDLKTTQKTFDSLIFSDNCYM\r\nNQAATKELLNLGMGEYFTYPKGVEFMKKIILHSTTPNEGDIILDFFAGSGTTVHAVMELN\r\nAEDKGNREFILVQIDEEIKEDESAYDFCKKELKSAKPVISDITIERVKRAAQKISQLSKD\r\nSGLDLGFKVYTLQDKVQIINDKEEITLFNRSDLTPFDKALNLALQCGKTLNQALEIIIKD\r\nKLYKCEDAYFCIVCDEEAQEYLAKSKNEMIFLDGYEEIDLEAFLNLNASFKERLSVVY",
"organism": "Helicobacter pylori",
"uniprot_code": "O25315",
"uniprot_range_first": 1,
"uniprot_range_last": 598,
"oligomerization": "dimer",
"molecular_type": "protein",
"uniprot_sequence": "MLLKNFPQTIKDGQVSLSAIKMLLGFNESMNDISGYELTWTGKGFANALYSEPCQKQLKL\nQESFTPQTSASKHPNNAIIIGDNLDALKLLKSAYSEKIKMIYIDPPYNTGNDEFIYPDNF\nRQDYQKILREVGLMEIDENGKEIESESLKFFKNTQGSGTHSGWLSFMLPRLKLARDLLKE\nDGVIFISIDDNECANLKILCDEIFGEDNFVGDFIRKTKSTTNDAKIGLNYQHEFLLCYAK\nDKNYTNLLGGEKNLENYKNPDNDPNGAWINDNPSAKSGNMKTGYFGVTNPYTNKVDYPPV\nGMFWRFSQNTIQKHIDEGRICFKKEHKDNERGFIYKRYLKDLKTTQKTFDSLIFSDNCYM\nNQAATKELLNLGMGEYFTYPKGVEFMKKIILHSTTPNEGDIILDFFAGSGTTVHAVMELN\nAEDKGNREFILVQIDEEIKEDESAYDFCKKELKSAKPVISDITIERVKRAAQKISQLSKD\nSGLDLGFKVYTLQDKVQIINDKEEITLFNRSDLTPFDKALNLALQCGKTLNQALEIIIKD\nKLYKCEDAYFCIVCDEEAQEYLAKSKNEMIFLDGYEEIDLEAFLNLNASFKERLSVVY",
"mw": 68.3,
"total_mw": 136.6,
"number_molecules": 2,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": null
}
],
"buffer": {
"name": "25 mM Tris, 250 mM NaCl",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 8.0,
"deuteration": null
},
"purity_method": null,
"name": "Adenine specific DNA methyltransferase (Mod Hp_0593) at pH 8",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": "RCB",
"address": "Haryana, India",
"full_name": "Regional Centre for Biotechnology",
"webpage": "http://www.rcb.res.in/"
}
],
"contributor_name": "Naveen",
"contributor_surname": "Narayanan",
"orcid": "https://orcid.org/0000-0001-8327-1559"
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2017-07-09",
"storage_temperature": 10.0,
"cell_temperature": 10.0,
"exposure_time": 0.5,
"number_of_frames": 10,
"wavelength": 0.0992,
"sample_detector_distance": null,
"concentration_min": null,
"concentration_max": 2.0,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.036,
"s_max": 4.939,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDFL6_fit1_model1_img.png",
"software": "PyMOL",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDFL6_fit1_model1.pdb",
"model_mw": 117.9,
"bead_radius": null,
"log": null,
"symmetry": null,
"comment": null,
"user": 451
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/dimer1_k366e_minim01_fixed_fit_img.png",
"software": "CRYSOL",
"chi_square_value": 1.219,
"p_value": 0.0,
"fit_residual_plot": "dimer1_k366e_minim01_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDFL6_fit1.fit",
"fit_log": null,
"software_version": "2.8.3",
"description": ""
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDFL6_fit2_model1_img.png",
"software": "PyMOL",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDFL6_fit2_model1.pdb",
"model_mw": 117.9,
"bead_radius": null,
"log": null,
"symmetry": null,
"comment": null,
"user": 451
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/dimer2_a194_minimized01_fixed_fit_img.png",
"software": "CRYSOL",
"chi_square_value": 2.085,
"p_value": 0.0,
"fit_residual_plot": "dimer2_a194_minimized01_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDFL6_fit2.fit",
"fit_log": null,
"software_version": "2.8.3",
"description": ""
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": null,
"experiment_description": "Synchrotron SAXS data from solutions of adenine specific DNA methyltransferase (Mod Hp_0593) at pH 8 in 25 mM Tris, 250 mM NaCl were collected on the ID14-3 beam line at the ESRF storage ring (Grenoble, France) using a Pilatus 1M detector at a wavelength of λ = 0.0992 nm (I(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). One solute concentration of 2.00 mg/ml was measured at 10°C. 10 successive 0.500 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 120.0,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 90.0,
"porod_mw_error": null,
"pddf_i0": 35.98,
"pddf_i0_error": null,
"guinier_i0": 35.57,
"guinier_i0_error": 0.086,
"pddf_rg": 3.375,
"pddf_rg_error": null,
"guinier_rg": 3.27,
"guinier_rg_error": 0.74,
"pddf_dmax": 12.5,
"pddf_dmax_error": null,
"porod_volume": 143.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 30,
"guinier_point_last": 77,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDFL6_datloglog_img.png",
"symmetry": null,
"last_modified": "2019-12-06T13:07:15.624532+01:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDFL6",
"status": "success",
"started_at": "2026-08-11T15:11:52.764339+00:00",
"finished_at": "2026-08-11T15:12:04.033331+00:00",
"source_last_modified": "2019-12-06T13:07:15.624532+01:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDFL6/",
"path": "/data/saxsdb/sasbdb/entries/l6/sasdfl6/source/summary.json",
"size": 9347,
"sha256": "a49bf869c087ca8f517a6849d0566dc76f67f735228a6b2c6597587780fb4854"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDFL6.dat",
"path": "/data/saxsdb/sasbdb/entries/l6/sasdfl6/source/SASDFL6.dat",
"size": 47453,
"sha256": "ead2062c6a920da27a1ae6f70db056de76c6594564fc8044b86268f03492de39",
"role": "curve"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDFL6.out",
"path": "/data/saxsdb/sasbdb/entries/l6/sasdfl6/source/SASDFL6.out",
"size": 58081,
"sha256": "77109e0132ce14bae588906e4b486572ccdff0ceef6b2fcfc89c63debaa3184d",
"role": "pddf"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDFL6.sascif",
"path": "/data/saxsdb/sasbdb/entries/l6/sasdfl6/source/SASDFL6.sascif",
"size": 1916724,
"sha256": "c856b197d437e1365b9b6f0e395bac4f48e7427b2cd11b209b37938a092d87e1",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDFL6.zip",
"path": "/data/saxsdb/sasbdb/entries/l6/sasdfl6/source/SASDFL6.zip",
"size": 788996,
"sha256": "549779ab64ab1470d7084c6996e0d5a0f35b0c50bd019710b721d9af92836be9",
"role": "full_entry_zip",
"zip_member_count": 6,
"zip_validation": "central_directory_readable"
}
]
}
