SASDG27

Salt stress-induced protein at a sample concentration of 22mg/ml

Data type: SASBDB experimental data Status: Published Curve type: Single concentration Last updated: 2020-10-28T14:30:50.727237+01:00

▼

1. Samples, Components and Experimental Conditions Sample & Experiment

Sample 1 · Salt stress-induced protein at a sample concentration of 22mg/ml

Concentration	— – 22.0	Buffer / pH	50 mM NaCl, 2.7 mM KCl, 10 mM Na2HPO4, 1.8 mM KH2PO4 / 7.4
Experimental temperature	10.0	Facility / beamline	CSIR - Institute of Microbial Technology (IMTech) / Anton Paar SAXSpace
Wavelength	0.15418 nm	Exposure	600.0 s × 3

Molecular Components

Component	Type / organism	UniProt and Construct	Oligomeric State	Molecular weight
Salt stress-induced protein View sequence >SLTMGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMTLVKIGLWGGNGGSAQDISVPPKKLLGVTIYSSDAIRSIAFNYIGVDGQEYAIGPWGGGEGTSTEIKLGSSEHIKEISGTHGPVYDLADIVTYLKIVTSANNTYEAGVPNGKEFSIPLQDSGHVVGFFGRSGTLIDAIGIYVHP	proteinOryza sativa Indica Group	A2WPN71–145	dimerMolecule count 2	18.741 kDa

Experimental Curves

Curve	Points / columns	q range	Uncertainty quality	Negative-intensity points	Source file
1	901[3]	0.1264075–6.000623 1/nm	Has uncertainty columnMissing 0	0	sasbdb/entries/27/sasdg27/source/SASDG27.dat

▼

2. Measurements Reported by SASBDB Reported Results

Metric	Method	Value	Uncertainty	Unit
dmax	P(r)	6.5	—	nm
i0	Guinier	80553.5	753.8	arbitrary
i0	P(r)	74920.0	—	arbitrary
mw	Experimental	41.9	—	kDa
mw	Porod	35.0	—	kDa
porod_volume	Porod	57.0	—	nm³
rg	Guinier	2.45	0.19	nm
rg	P(r)	2.3	—	nm

These values are reported by SASBDB; SAXSdb did not recalculate them from the experimental curve.

▼

3. Source Fits and Models Source Fits & Models

This entry has no source fit record.

▶

4. Source File Index Source Files

Category	Path	Download status	Size
curve	sasbdb/entries/27/sasdg27/source/SASDG27.dat	downloaded	32319
full_entry_zip	sasbdb/entries/27/sasdg27/source/SASDG27.zip	downloaded	25334
pddf	sasbdb/entries/27/sasdg27/source/SASDG27.out	downloaded	39242
sascif	sasbdb/entries/27/sasdg27/source/SASDG27.sascif	downloaded	79611
summary	sasbdb/entries/27/sasdg27/source/summary.json	downloaded	6240

▶

5. Experiment Description and Publication Experiment & Publication

▼

6. Complete Source Record Complete Source Record

The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.

Open the original SASBDB entry

Buffer and Sample Properties

Buffer name	50 mM NaCl, 2.7 mM KCl, 10 mM Na2HPO4, 1.8 mM KH2PO4	Buffer concentration	—
pH	7.4	Additives	—
Buffer description	—
Purity measurement method	—	Extinction coefficient	—
Absorbance	—	Scattering contrast	—
Specific volume / dry volume	— / —	Mixture / deuteration	— / —

Acquisition Conditions and Instrument

Measurement date	2017-03-06	Storage / measurement temperature	4.0 / 10.0
Exposure time	600.0	Frames	3
Wavelength	0.15418	Sample-to-detector distance	0.3176
Source	X-ray in house	Detector	Mythen 1K
Facility / beamline	CSIR - Institute of Microbial Technology (IMTech) / Anton Paar SAXSpace · Chandigarh, India
q range	0.126 – 6.001	Sample volume / flow rate	— / —

Original SASBDB Plots

Downloadable Files

Category	File	Status	Size	Checksum	Download and View
curve	sasbdb/entries/27/sasdg27/source/SASDG27.dat	downloaded	32319	b8a4f9e789116dcdfb3d8fea372bf45f3aecdf5e19af9b26ecf71a8746cb716e	DownloadView source fileSource site
full_entry_zip	sasbdb/entries/27/sasdg27/source/SASDG27.zip	downloaded	25334	dbad312aa11bca8c75c1263e5ef6090802b3251c4765c622601d9f4322060a6d	DownloadView source fileSource site
pddf	sasbdb/entries/27/sasdg27/source/SASDG27.out	downloaded	39242	cff3e8ab111c590f68373009af2647bebd84202b45eef084d37498d2a49605cf	DownloadView source fileSource site
sascif	sasbdb/entries/27/sasdg27/source/SASDG27.sascif	downloaded	79611	cf5800bfcea70940afa868502669c786b625bec62662eff8d28df4dbc79f2830	DownloadView source fileSource site
summary	sasbdb/entries/27/sasdg27/source/summary.json	downloaded	6240	b79b8d3eecf083b9b027e29a107afa04f0a6d64a8b33f2e6a20ee3026133e6d9	DownloadView source fileSource site

curve：source record

{
  "path": "/data/saxsdb/sasbdb/entries/27/sasdg27/source/SASDG27.dat",
  "role": "curve",
  "sha256": "b8a4f9e789116dcdfb3d8fea372bf45f3aecdf5e19af9b26ecf71a8746cb716e",
  "size": 32319,
  "status": "downloaded",
  "url": "https://www.sasbdb.org/media/intensities_files/SASDG27.dat"
}

full_entry_zip：source record and ZIP contents (2 items)

{
  "path": "/data/saxsdb/sasbdb/entries/27/sasdg27/source/SASDG27.zip",
  "role": "full_entry_zip",
  "sha256": "dbad312aa11bca8c75c1263e5ef6090802b3251c4765c622601d9f4322060a6d",
  "size": 25334,
  "status": "downloaded",
  "url": "https://www.sasbdb.org/media/zip_directories/SASDG27.zip",
  "zip_member_count": 2,
  "zip_members": [
    {
      "crc32": "01c8a4e7",
      "name": "SASDG27/experimental_data/SASDG27.dat",
      "size": 32319
    },
    {
      "crc32": "5ad94c11",
      "name": "SASDG27/pddf/SASDG27.out",
      "size": 39242
    }
  ],
  "zip_validation": "central_directory_readable"
}

pddf：source record

{
  "path": "/data/saxsdb/sasbdb/entries/27/sasdg27/source/SASDG27.out",
  "role": "pddf",
  "sha256": "cff3e8ab111c590f68373009af2647bebd84202b45eef084d37498d2a49605cf",
  "size": 39242,
  "status": "downloaded",
  "url": "https://www.sasbdb.org/media/p_of_R_files/SASDG27.out"
}

sascif：source record

{
  "path": "/data/saxsdb/sasbdb/entries/27/sasdg27/source/SASDG27.sascif",
  "role": "sascif",
  "sha256": "cf5800bfcea70940afa868502669c786b625bec62662eff8d28df4dbc79f2830",
  "size": 79611,
  "status": "downloaded",
  "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDG27.sascif"
}

summary：source record

{
  "path": "/data/saxsdb/sasbdb/entries/27/sasdg27/source/summary.json",
  "sha256": "b79b8d3eecf083b9b027e29a107afa04f0a6d64a8b33f2e6a20ee3026133e6d9",
  "size": 6240,
  "status": "downloaded",
  "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDG27/"
}

All source fields (unfiltered)

Every source field is expanded here, including empty values, list members and fields already shown above.

summary.json：134 field values

Field path	Raw value
code	SASDG27
status	Published
type_of_curve	Single concentration
angular_unit	1/nm
project.title	Structural insights into rice SalTol QTL located SALT protein.
project.publication.title	Structural insights into rice SalTol QTL located SALT protein.
project.publication.author_list	Kaur N, Sagar A, Sharma P, Ashish, Pati PK
project.publication.journal	Sci Rep
project.publication.doi	10.1038/s41598-020-73517-y
project.publication.pmid	33024209
project.publication.published_date	2020 Oct 6
project.status	released
project.submitted_date	2019-10-14
project.released_date	2020-10-28
pddf_data	https://www.sasbdb.org/media/p_of_R_files/SASDG27.out
intensities_data	https://www.sasbdb.org/media/intensities_files/SASDG27.dat
intensities_log_plot	https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDG27_dat_img.png
intensities_kratky_plot	https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDG27_kratky_img.png
pddf_plot	https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDG27_pofr_img.png
intensities_guinier_plot	https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDG27_guinier_img.png
sascif_data	https://www.sasbdb.org/media/sascif/sascif_files/SASDG27.sascif
experiment.instrument.detector.type	1D diode array detector
experiment.instrument.detector.name	Mythen 1K
experiment.instrument.detector.resolution	50.0
experiment.instrument.name	CSIR - Institute of Microbial Technology (IMTech)
experiment.instrument.city	Chandigarh
experiment.instrument.country	India
experiment.instrument.beamline_name	Anton Paar SAXSpace
experiment.instrument.beam_geometry	null
experiment.instrument.type_of_source	X-ray in house
experiment.instrument.point_source	null
experiment.instrument.line_collimation	null
experiment.instrument.sample_path_length	null
experiment.instrument.line_collimation_slitlength	null
experiment.instrument.line_collimation_integrationwidth	null
experiment.instrument.xray_energy	null
experiment.instrument.beam_profile_ah	null
experiment.instrument.beam_profile_al	null
experiment.sample.molecule[0].long_name	Salt stress-induced protein
experiment.sample.molecule[0].short_name	SALT
experiment.sample.molecule[0].sequence	>SLT MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMTLVKIGLWGGNGGSAQDISVPPKKLLGVTIYSSDAIRSIAFNYIGVDGQEYAIGPWGGGEGTSTEIKLGSSEHIKEISGTHGPVYDLADIVTYLKIVTSANNTYEAGVPNGKEFSIPLQDSGHVVGFFGRSGTLIDAIGIYVHP
experiment.sample.molecule[0].organism	Oryza sativa Indica Group
experiment.sample.molecule[0].uniprot_code	A2WPN7
experiment.sample.molecule[0].uniprot_range_first	1
experiment.sample.molecule[0].uniprot_range_last	145
experiment.sample.molecule[0].oligomerization	dimer
experiment.sample.molecule[0].molecular_type	protein
experiment.sample.molecule[0].uniprot_sequence	MTLVKIGLWGGNGGSAQDISVPPKKLLGVTIYSSDAIRSIAFNYIGVDGQEYAIGPWGGG EGTSTEIKLGSSEHIKEISGTHGPVYDLADIVTYLKIVTSANNTYEAGVPNGKEFSIPLQ DSGHVVGFFGRSGTLIDAIGIYVHP
experiment.sample.molecule[0].mw	18.741
experiment.sample.molecule[0].total_mw	37.482
experiment.sample.molecule[0].number_molecules	2
experiment.sample.molecule[0].complex_state	False
experiment.sample.molecule[0].deuteration	null
experiment.sample.molecule[0].molecule_source	biological
experiment.sample.molecule[0].molecule_description	null
experiment.sample.buffer.name	50 mM NaCl, 2.7 mM KCl, 10 mM Na2HPO4, 1.8 mM KH2PO4
experiment.sample.buffer.concentration_unit	null
experiment.sample.buffer.comment	null
experiment.sample.buffer.additive	null
experiment.sample.buffer.concentration	null
experiment.sample.buffer.pka	null
experiment.sample.buffer.ph	7.4
experiment.sample.buffer.deuteration	null
experiment.sample.purity_method	null
experiment.sample.name	Salt stress-induced protein at a sample concentration of 22mg/ml
experiment.sample.ext_coefficient	null
experiment.sample.contrast	null
experiment.sample.specific_vol	null
experiment.sample.dry_vol	null
experiment.sample.absorbption	null
experiment.sample.deuteration	null
experiment.sample.mixture	null
experiment.contributor[0].affiliation[0].short_name	CSIR
experiment.contributor[0].affiliation[0].address	Chandigarh, India
experiment.contributor[0].affiliation[0].full_name	CSIR-Institute of Microbial Technology
experiment.contributor[0].affiliation[0].webpage	http://www.imtech.res.in/
experiment.contributor[0].contributor_name	Amin
experiment.contributor[0].contributor_surname	Sagar
experiment.contributor[0].orcid
experiment.concentration_method	null
experiment.concentration_unit	null
experiment.date	2017-03-06
experiment.storage_temperature	4.0
experiment.cell_temperature	10.0
experiment.exposure_time	600.0
experiment.number_of_frames	3
experiment.wavelength	0.15418
experiment.sample_detector_distance	0.3176
experiment.concentration_min	null
experiment.concentration_max	22.0
experiment.sample_volume	null
experiment.flow_rate	null
experiment.s_min	0.126
experiment.s_max	6.001
experiment.total_exposure_time	null
experiment.seccolumn	null
fits	[]
estimated_volume_method	null
pddf_software	ATSAS GNOM
pddf_software_version	5.0
i0_calibration_standard	null
description	null
experiment_description	SAXS data from solutions of salt stress-induced protein in 50 mM NaCl, 2.7 mM KCl, 10 mM Na2HPO4, 1.8 mM KH2PO4, pH 7.4 were collected using an Anton Paar SAXSpace instrument (CSIR - Institute of Microbial Technology (IMTech), Chandigarh, India) equipped with a Mythen 1K detector at a sample-detector distance of 0.3 m and at a wavelength of λ = 0.15418 nm (I(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). One solute concentration of 22.00 mg/ml was measured at 10°C. Three successive 600 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.
tags	[]
intensity_unit	arbitrary
experimental_mw	41.9
experimental_mw_error	null
guinier_i0_mw	null
guinier_i0_mw_error	null
porod_mw	35.0
porod_mw_error	null
pddf_i0	74920.0
pddf_i0_error	null
guinier_i0	80553.5
guinier_i0_error	753.8
pddf_rg	2.3
pddf_rg_error	null
guinier_rg	2.45
guinier_rg_error	0.19
pddf_dmax	6.5
pddf_dmax_error	null
porod_volume	57.0
porod_volume_error	null
estimated_volume	null
estimated_volume_error	null
guinier_point_first	11
guinier_point_last	64
pddf_point_first	null
pddf_point_last	null
i0_calibration_standard_data	null
intensities_log_log_plot	SASDG27_datloglog_img.png
symmetry	null
last_modified	2020-10-28T14:30:50.727237+01:00
bragg_peak	[]

manifest.json：36 field values

Field path	Raw value
code	SASDG27
status	success
started_at	2026-08-11T15:20:15.565930+00:00
finished_at	2026-08-11T15:20:23.392876+00:00
source_last_modified	2020-10-28T14:30:50.727237+01:00
files[0].status	downloaded
files[0].url	https://www.sasbdb.org/rest-api/entry/summary/SASDG27/
files[0].path	/data/saxsdb/sasbdb/entries/27/sasdg27/source/summary.json
files[0].size	6240
files[0].sha256	b79b8d3eecf083b9b027e29a107afa04f0a6d64a8b33f2e6a20ee3026133e6d9
files[1].status	downloaded
files[1].url	https://www.sasbdb.org/media/intensities_files/SASDG27.dat
files[1].path	/data/saxsdb/sasbdb/entries/27/sasdg27/source/SASDG27.dat
files[1].size	32319
files[1].sha256	b8a4f9e789116dcdfb3d8fea372bf45f3aecdf5e19af9b26ecf71a8746cb716e
files[1].role	curve
files[2].status	downloaded
files[2].url	https://www.sasbdb.org/media/p_of_R_files/SASDG27.out
files[2].path	/data/saxsdb/sasbdb/entries/27/sasdg27/source/SASDG27.out
files[2].size	39242
files[2].sha256	cff3e8ab111c590f68373009af2647bebd84202b45eef084d37498d2a49605cf
files[2].role	pddf
files[3].status	downloaded
files[3].url	https://www.sasbdb.org/media/sascif/sascif_files/SASDG27.sascif
files[3].path	/data/saxsdb/sasbdb/entries/27/sasdg27/source/SASDG27.sascif
files[3].size	79611
files[3].sha256	cf5800bfcea70940afa868502669c786b625bec62662eff8d28df4dbc79f2830
files[3].role	sascif
files[4].status	downloaded
files[4].url	https://www.sasbdb.org/media/zip_directories/SASDG27.zip
files[4].path	/data/saxsdb/sasbdb/entries/27/sasdg27/source/SASDG27.zip
files[4].size	25334
files[4].sha256	dbad312aa11bca8c75c1263e5ef6090802b3251c4765c622601d9f4322060a6d
files[4].role	full_entry_zip
files[4].zip_member_count	2
files[4].zip_validation	central_directory_readable

View the complete summary.json source

{
  "code": "SASDG27",
  "status": "Published",
  "type_of_curve": "Single concentration",
  "angular_unit": "1/nm",
  "project": {
    "title": "Structural insights into rice SalTol QTL located SALT protein.",
    "publication": {
      "title": "Structural insights into rice SalTol QTL located SALT protein.",
      "author_list": "Kaur N, Sagar A, Sharma P, Ashish, Pati PK",
      "journal": "Sci Rep",
      "doi": "10.1038/s41598-020-73517-y",
      "pmid": "33024209",
      "published_date": "2020 Oct 6"
    },
    "status": "released",
    "submitted_date": "2019-10-14",
    "released_date": "2020-10-28"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDG27.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDG27.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDG27_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDG27_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDG27_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDG27_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDG27.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": "1D diode array detector",
        "name": "Mythen 1K",
        "resolution": 50.0
      },
      "name": "CSIR - Institute of Microbial Technology (IMTech)",
      "city": "Chandigarh",
      "country": "India",
      "beamline_name": "Anton Paar SAXSpace",
      "beam_geometry": null,
      "type_of_source": "X-ray in house",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Salt stress-induced protein",
          "short_name": "SALT",
          "sequence": ">SLT\r\nMGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSMTLVKIGLWGGNGGSAQDISVPPKKLLGVTIYSSDAIRSIAFNYIGVDGQEYAIGPWGGGEGTSTEIKLGSSEHIKEISGTHGPVYDLADIVTYLKIVTSANNTYEAGVPNGKEFSIPLQDSGHVVGFFGRSGTLIDAIGIYVHP",
          "organism": "Oryza sativa Indica Group",
          "uniprot_code": "A2WPN7",
          "uniprot_range_first": 1,
          "uniprot_range_last": 145,
          "oligomerization": "dimer",
          "molecular_type": "protein",
          "uniprot_sequence": "MTLVKIGLWGGNGGSAQDISVPPKKLLGVTIYSSDAIRSIAFNYIGVDGQEYAIGPWGGG\nEGTSTEIKLGSSEHIKEISGTHGPVYDLADIVTYLKIVTSANNTYEAGVPNGKEFSIPLQ\nDSGHVVGFFGRSGTLIDAIGIYVHP",
          "mw": 18.741,
          "total_mw": 37.482,
          "number_molecules": 2,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "50 mM NaCl, 2.7 mM KCl, 10 mM Na2HPO4, 1.8 mM KH2PO4",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 7.4,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Salt stress-induced protein at a sample concentration of 22mg/ml",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": "CSIR",
            "address": "Chandigarh, India",
            "full_name": "CSIR-Institute of Microbial Technology",
            "webpage": "http://www.imtech.res.in/"
          }
        ],
        "contributor_name": "Amin",
        "contributor_surname": "Sagar",
        "orcid": ""
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2017-03-06",
    "storage_temperature": 4.0,
    "cell_temperature": 10.0,
    "exposure_time": 600.0,
    "number_of_frames": 3,
    "wavelength": 0.15418,
    "sample_detector_distance": 0.3176,
    "concentration_min": null,
    "concentration_max": 22.0,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.126,
    "s_max": 6.001,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": "5.0",
  "i0_calibration_standard": null,
  "description": null,
  "experiment_description": "SAXS data from solutions of salt stress-induced protein in 50 mM NaCl, 2.7 mM KCl, 10 mM Na2HPO4, 1.8 mM KH2PO4, pH 7.4 were collected using an Anton Paar SAXSpace instrument (CSIR - Institute of Microbial Technology (IMTech), Chandigarh, India) equipped with a Mythen 1K detector at a sample-detector distance of 0.3 m and at a wavelength of λ = 0.15418 nm (I(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). One solute concentration of 22.00 mg/ml was measured at 10°C. Three successive 600 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
  "tags": [],
  "intensity_unit": "arbitrary",
  "experimental_mw": 41.9,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": 35.0,
  "porod_mw_error": null,
  "pddf_i0": 74920.0,
  "pddf_i0_error": null,
  "guinier_i0": 80553.5,
  "guinier_i0_error": 753.8,
  "pddf_rg": 2.3,
  "pddf_rg_error": null,
  "guinier_rg": 2.45,
  "guinier_rg_error": 0.19,
  "pddf_dmax": 6.5,
  "pddf_dmax_error": null,
  "porod_volume": 57.0,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 11,
  "guinier_point_last": 64,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDG27_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2020-10-28T14:30:50.727237+01:00",
  "bragg_peak": []
}

View the complete manifest.json source

{
  "code": "SASDG27",
  "status": "success",
  "started_at": "2026-08-11T15:20:15.565930+00:00",
  "finished_at": "2026-08-11T15:20:23.392876+00:00",
  "source_last_modified": "2020-10-28T14:30:50.727237+01:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDG27/",
      "path": "/data/saxsdb/sasbdb/entries/27/sasdg27/source/summary.json",
      "size": 6240,
      "sha256": "b79b8d3eecf083b9b027e29a107afa04f0a6d64a8b33f2e6a20ee3026133e6d9"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDG27.dat",
      "path": "/data/saxsdb/sasbdb/entries/27/sasdg27/source/SASDG27.dat",
      "size": 32319,
      "sha256": "b8a4f9e789116dcdfb3d8fea372bf45f3aecdf5e19af9b26ecf71a8746cb716e",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDG27.out",
      "path": "/data/saxsdb/sasbdb/entries/27/sasdg27/source/SASDG27.out",
      "size": 39242,
      "sha256": "cff3e8ab111c590f68373009af2647bebd84202b45eef084d37498d2a49605cf",
      "role": "pddf"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDG27.sascif",
      "path": "/data/saxsdb/sasbdb/entries/27/sasdg27/source/SASDG27.sascif",
      "size": 79611,
      "sha256": "cf5800bfcea70940afa868502669c786b625bec62662eff8d28df4dbc79f2830",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDG27.zip",
      "path": "/data/saxsdb/sasbdb/entries/27/sasdg27/source/SASDG27.zip",
      "size": 25334,
      "sha256": "dbad312aa11bca8c75c1263e5ef6090802b3251c4765c622601d9f4322060a6d",
      "role": "full_entry_zip",
      "zip_member_count": 2,
      "zip_validation": "central_directory_readable"
    }
  ]
}

Title	Structural insights into rice SalTol QTL located SALT protein.
Authors	Kaur N, Sagar A, Sharma P, Ashish, Pati PK
DOI / PMID	10.1038/s41598-020-73517-y / 33024209