Deglycosylated latency associated peptide, LAP (TGFB-1)

{
  "code": "SASDG55",
  "status": "Published",
  "type_of_curve": "Single concentration",
  "angular_unit": "1/A",
  "project": {
    "title": "Structural insights into conformational switching in latency-associated peptide between transforming growth factor β-1 bound and unbound states",
    "publication": {
      "title": "Structural insights into conformational switching in latency-associated peptide between transforming growth factor β-1 bound and unbound states",
      "author_list": "Stachowski T, Snell M, Snell E",
      "journal": "IUCrJ",
      "doi": "10.1107/S205225251901707X",
      "pmid": null,
      "published_date": "2020 Feb 06"
    },
    "status": "released",
    "submitted_date": "2019-09-04",
    "released_date": "2020-02-28"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDG55.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDG55.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDG55_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDG55_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDG55_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDG55_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDG55.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": null,
        "name": "Pilatus3 X 2M",
        "resolution": 172.0
      },
      "name": "Advanced Light Source (ALS)",
      "city": "Berkeley, CA",
      "country": "USA",
      "beamline_name": "12.3.1 (SIBYLS)",
      "beam_geometry": "",
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Latency associated peptide",
          "short_name": "LAP",
          "sequence": ">sp|P01137|30-278\r\nLSTCKTIDMELVKRKRIEAIRGQILSKLRLASPPSQGEVPPGPLPEAVLALYNSTRDRVA\r\nGESAEPEPEPEADYYAKEVTRVLMVETHNEIYDKFKQSTHSIYMFFNTSELREAVPEPVL\r\nLSRAELRLLRLKLKVEQHVELYQKYSNNSWRYLSNRLLAPSDSPEWLSFDVTGVVRQWLS\r\nRGGEIEGFRLSAHCSCDSRDNTLQVDINGFTTGRRGDLATIHGMNRPFLLLMATPLERAQ\r\nHLQSSRHRAHHHHHH",
          "organism": "Homo sapiens",
          "uniprot_code": "P01137",
          "uniprot_range_first": 30,
          "uniprot_range_last": 277,
          "oligomerization": "dimer",
          "molecular_type": "protein",
          "uniprot_sequence": "MPPSGLRLLLLLLPLLWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLA\nSPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVETHNEI\nYDKFKQSTHSIYMFFNTSELREAVPEPVLLSRAELRLLRLKLKVEQHVELYQKYSNNSWR\nYLSNRLLAPSDSPEWLSFDVTGVVRQWLSRGGEIEGFRLSAHCSCDSRDNTLQVDINGFT\nTGRRGDLATIHGMNRPFLLLMATPLERAQHLQSSRHRRALDTNYCFSSTEKNCCVRQLYI\nDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQA\nLEPLPIVYYVGRKPKVEQLSNMIVRSCKCS",
          "mw": 29.228,
          "total_mw": 58.456,
          "number_molecules": 2,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": null
        }
      ],
      "buffer": {
        "name": "phosphate buffered saline 2% glycerol",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 7.4,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Deglycosylated latency associated peptide, LAP (TGFB-1)",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": null,
            "address": "New York, USA",
            "full_name": "Hauptman-Woodward Medical Research Institute",
            "webpage": "http://hwi.buffalo.edu/"
          }
        ],
        "contributor_name": "Tim",
        "contributor_surname": "Stachowski",
        "orcid": "https://orcid.org/0000-0002-6097-4857"
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2019-04-20",
    "storage_temperature": 4.0,
    "cell_temperature": 10.0,
    "exposure_time": 0.1,
    "number_of_frames": 100,
    "wavelength": 0.127,
    "sample_detector_distance": 2.0,
    "concentration_min": null,
    "concentration_max": 1.4,
    "sample_volume": null,
    "flow_rate": null,
    "s_min": 0.109,
    "s_max": 2.611,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": "5.0",
  "i0_calibration_standard": null,
  "description": null,
  "experiment_description": "Synchrotron SAXS data from solutions of deglycosylated latency associated peptide (LAP) from the transforming growth factor beta-1 proprotein (TGFB-1) in phosphate buffered saline, 2% glycerol, pH 7.4 were collected on the 12.3.1 (SIBYLS) beam line at the Advanced Light Source (ALS; Berkeley, CA, USA) using a Pilatus3 X 2M detector at a sample-detector distance of 2 m and at a wavelength of λ = 0.127 nm (I(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). One solute concentration of 1.40 mg/ml was measured at 10°C. 100 successive 0.100 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
  "tags": [],
  "intensity_unit": "arbitrary",
  "experimental_mw": 59.1,
  "experimental_mw_error": null,
  "guinier_i0_mw": 47.0,
  "guinier_i0_mw_error": 5.0,
  "porod_mw": null,
  "porod_mw_error": null,
  "pddf_i0": 1.987,
  "pddf_i0_error": null,
  "guinier_i0": 1.99,
  "guinier_i0_error": 0.01,
  "pddf_rg": 3.55,
  "pddf_rg_error": null,
  "guinier_rg": 3.51,
  "guinier_rg_error": 0.11,
  "pddf_dmax": 13.0,
  "pddf_dmax_error": null,
  "porod_volume": 129.0,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": null,
  "guinier_point_last": null,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDG55_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2020-02-28T18:01:03.158567+01:00",
  "bragg_peak": []
}

{
  "code": "SASDG55",
  "status": "success",
  "started_at": "2026-08-11T14:38:48.872881+00:00",
  "finished_at": "2026-08-11T14:38:56.807631+00:00",
  "source_last_modified": "2020-02-28T18:01:03.158567+01:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDG55/",
      "path": "/data/saxsdb/sasbdb/entries/55/sasdg55/source/summary.json",
      "size": 6743,
      "sha256": "019003a5a05e1408b6db14b56b0337ad9096f44534e98d5d9f40aea97725cbe7"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDG55.dat",
      "path": "/data/saxsdb/sasbdb/entries/55/sasdg55/source/SASDG55.dat",
      "size": 20598,
      "sha256": "02ad6c8cb4203b57c57a628658a02b701726a59e21f0f25151aa3a15932a4997",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDG55.out",
      "path": "/data/saxsdb/sasbdb/entries/55/sasdg55/source/SASDG55.out",
      "size": 47604,
      "sha256": "ca4eae66c1f34c0d754fbf35af4eea8c30655d748516e7c4bc2688af8ecec8a4",
      "role": "pddf"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDG55.sascif",
      "path": "/data/saxsdb/sasbdb/entries/55/sasdg55/source/SASDG55.sascif",
      "size": 62349,
      "sha256": "4ae018d6c41274caf1b6b5353cd5833937b728840c4813ae0fc64dc37ef9d2f9",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDG55.zip",
      "path": "/data/saxsdb/sasbdb/entries/55/sasdg55/source/SASDG55.zip",
      "size": 18505,
      "sha256": "36d81d22e5753b28696458638419acdf8a77ef9958252f5fc5bd72b23191663b",
      "role": "full_entry_zip",
      "zip_member_count": 2,
      "zip_validation": "central_directory_readable"
    }
  ]
}