The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDVT2",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/nm",
"project": {
"title": "Plasmodium falciparum nucleoplasmin (PfNPM)",
"publication": null,
"status": "released",
"submitted_date": "2024-06-13",
"released_date": "2026-06-13"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDVT2.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDVT2.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDVT2_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDVT2_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDVT2_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDVT2_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDVT2.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Pilatus3 2M",
"resolution": 0.172
},
"name": "ESRF",
"city": "Grenoble",
"country": "France",
"beamline_name": "BM29",
"beam_geometry": "point",
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "PfNPM A3 (1-170)",
"short_name": "PfNPM A3",
"sequence": "MFYGKVVKPDETVVPEVKDGYSVIHLSRACLNNPEHEGKIYVQVEDGNGCYNICCLQKNV\r\nCEDTPLDIFLMLDNDVKIKTSGSSNEVHIVGYYEVSFGQDNLDEDEDEFEDEFDNDEVRM\r\nLTKKNTLKNSLSNGISKRKKNLENNEDDETNVGRNDEDDDDEDDEDDEDELEHHHHHH",
"organism": "Plasmodium falciparum 3D7",
"uniprot_code": "C0H4U4",
"uniprot_range_first": 1,
"uniprot_range_last": 170,
"oligomerization": "pentamer",
"molecular_type": "protein",
"uniprot_sequence": "MFYGKVVKPDETVVPEVKDGYSVIHLSRACLNNPEHEGKIYVQVEDGNGCYNICCLQKNV\nCEDTPLDIFLMLDNDVKIKTSGSSNEVHIVGYYEVSFGQDNLDEDEDEFEDEFDNDEVRM\nLTKKNTLKNSLSNGISKRKKNLENNEDDETNVGRNDEDDDDEDDEDDEDEEEDDDEEDED\nDEEDDEDDDDEEEEDEEDEDEEGEDEDDEEDEEEEEEEDEEGEDVENKKKGGDKKKNKRS\nLDNKSDGPLKKSKIDDEGQFEKDLVAFLKKNGKSKLTELGKVKKPEGLKMKLGFFIKKHS\nNVFKFDTEGQIVSLK",
"mw": 20.511,
"total_mw": 102.555,
"number_molecules": 5,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": ""
},
{
"long_name": "Histone H2A type 1-B/E",
"short_name": "H2A",
"sequence": "MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLT\r\nAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK\r\nTESHHKAKGK",
"organism": "Homo sapiens",
"uniprot_code": "P04908",
"uniprot_range_first": 1,
"uniprot_range_last": 130,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLT\nAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK\nTESHHKAKGK",
"mw": 14.135,
"total_mw": 14.135,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": ""
},
{
"long_name": "Histone H2B type 1-C/E/F/G/I",
"short_name": "H2B",
"sequence": "MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK",
"organism": "Homo sapiens",
"uniprot_code": "P62807",
"uniprot_range_first": 1,
"uniprot_range_last": 126,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM\nGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT\nKYTSSK",
"mw": 13.906,
"total_mw": 13.906,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": ""
}
],
"buffer": {
"name": "20 mM Tris, 150 mM NaCl, 2 mM β-mercaptoethanol",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.5,
"deuteration": null
},
"purity_method": null,
"name": "Nucleoplasmin-like domain-containing protein PfNPM (1-170) - H2A/H2B histone oligomer complex",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": "India",
"full_name": "Institute of Life Sciences (ILS)",
"webpage": "https://www.ils.res.in/"
}
],
"contributor_name": "Ketul",
"contributor_surname": "Saharan",
"orcid": ""
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2022-06-28",
"storage_temperature": 4.0,
"cell_temperature": 20.0,
"exposure_time": 20.0,
"number_of_frames": 10,
"wavelength": 0.09794,
"sample_detector_distance": 2.867,
"concentration_min": null,
"concentration_max": 1.0,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.051,
"s_max": 5.217,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDVT2_fit1_model1_img.png",
"software": "DAMMIF",
"pdb_link": [],
"model_title": null,
"type_of_model": "dummy",
"software_version": "DAMAVER 5.0 (r12736)",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDVT2_fit1_model1.pdb",
"model_mw": 151.85,
"bead_radius": null,
"log": null,
"symmetry": null,
"comment": null,
"user": 757
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDVT2_fit1_fixed_fit_img.png",
"software": "DAMMIF",
"chi_square_value": 1.118,
"p_value": 0.0765,
"fit_residual_plot": "SASDVT2_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDVT2_fit1.fir",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/N9.log",
"software_version": null,
"description": ""
},
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDVT2_fit2_model1_img.png",
"software": "FoXSDock",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDVT2_fit2_model1.pdb",
"model_mw": 124.9,
"bead_radius": null,
"log": null,
"symmetry": null,
"comment": null,
"user": 757
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDVT2_fit2_fixed_fit_img.png",
"software": "FoXSDock",
"chi_square_value": 1.388005,
"p_value": 0.0,
"fit_residual_plot": "SASDVT2_fit2_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDVT2_fit2.fit",
"fit_log": null,
"software_version": null,
"description": ""
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": null,
"experiment_description": null,
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 129.0,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 134.73,
"porod_mw_error": null,
"pddf_i0": 96.69,
"pddf_i0_error": null,
"guinier_i0": 97.0852,
"guinier_i0_error": null,
"pddf_rg": 4.493,
"pddf_rg_error": null,
"guinier_rg": 4.46,
"guinier_rg_error": 0.114,
"pddf_dmax": 13.9,
"pddf_dmax_error": null,
"porod_volume": 229.04,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 2,
"guinier_point_last": 31,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDVT2_datloglog_img.png",
"symmetry": null,
"last_modified": "2026-06-12T19:50:21.739828+02:00",
"bragg_peak": []
}
