Glutamine C‐methyltransferase without cobalamin from Methanoculleus thermophilus

{
  "code": "SASDVY7",
  "status": "Published",
  "type_of_curve": "SEC-SAS",
  "angular_unit": "1/A",
  "project": {
    "title": "Insights into the stereochemical mechanism of the B(12)-dependent radical SAM glutamine C- methyltransferase (QCMT).",
    "publication": {
      "title": "Insights into the stereochemical mechanism of the B(12)-dependent radical SAM glutamine C- methyltransferase (QCMT).",
      "author_list": "Bourdin T, Guillot A, Mauger M, Lefranc B, Gervason S, Glousieau M, Grimaldi S, Leprince J, Thureau A, Benjdia A, Berteau O",
      "journal": "Commun Biol",
      "doi": "10.1038/s42003-026-10234-8",
      "pmid": "42168528",
      "published_date": "2026 May 21"
    },
    "status": "released",
    "submitted_date": "2024-05-17",
    "released_date": "2026-05-17"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDVY7.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDVY7_fit1.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDVY7_fit1_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDVY7_fit1_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDVY7_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDVY7_fit1_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDVY7.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": null,
        "name": "Eiger 4M",
        "resolution": 75.0
      },
      "name": "SOLEIL",
      "city": "Saint-Aubin",
      "country": "France",
      "beamline_name": "SWING",
      "beam_geometry": null,
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "B12-binding domain/radical SAM domain protein, MJ_0865 family",
          "short_name": "QCMTMe",
          "sequence": "MDITIFSPGIYTYGAMLIGGVLRDAGHEVTLTRTPEVPEGSLLLASLFST\r\nQHLLDPKIRSLVRRHRERGGTVYVGGPVSAVPEIVLRELAPDAVVVGEGE\r\nETVVRLAEEGASETLPGIAYLDGDQAVVTAPAPPAPIDRPLPLIPEDIGS\r\nQSIRGASAYIETHRGCIGGCTFCQVPRFFGREVRSRPLESIIEEVKAFRA\r\nAGAKRLSISGGTGSLYGSHGCEMNPGAFIALLRGMAEVMGPKNVSAPDIR\r\nVDCITDEILDAIRQYTIGWVFFGIESGSNRVLRQMGKGATVREVEEAVER\r\nCREHGLHVAGSFIVGYPGETERDYEATKDLVAALSLDDVFISSAEPIPGT\r\nPLADLVIRTPRDKNPAFMPHTGEYRALHLTESEARCFDLMMHADMYRPQI\r\nRLVTDEVYAAYLAEAKKQGEDIRAATELILRYAQR",
          "organism": "Methanoculleus thermophilus",
          "uniprot_code": "WP_0669576",
          "uniprot_range_first": 1,
          "uniprot_range_last": 435,
          "oligomerization": "monomer",
          "molecular_type": "protein",
          "uniprot_sequence": "MDITIFSPGIYTYGAMLIGGVLRDAGHEVTLTRTPEVPEGSLLLASLFSTQHLLDPKIRS\r\nLVRRHRERGGTVYVGGPVSAVPEIVLRELAPDAVVVGEGEETVVRLAEEGASETLPGIAY\r\nLDGDQAVVTAPAPPAPIDRPLPLIPEDIGSQSIRGASAYIETHRGCIGGCTFCQVPRFFG\r\nREVRSRPLESIIEEVKAFRAAGAKRLSISGGTGSLYGSHGCEMNPGAFIALLRGMAEVMG\r\nPKNVSAPDIRVDCITDEILDAIRQYTIGWVFFGIESGSNRVLRQMGKGATVREVEEAVER\r\nCREHGLHVAGSFIVGYPGETERDYEATKDLVAALSLDDVFISSAEPIPGTPLADLVIRTP\r\nRDKNPAFMPHTGEYRALHLTESEARCFDLMMHADMYRPQIRLVTDEVYAAYLAEAKKQGE\r\nDIRAATELILRYAQR",
          "mw": 49.962,
          "total_mw": 49.962,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": "Apo protein with an Fe-S cluster. The protein construct used for SAXS contains an additional amino acid extension at the N-terminus (MASWSHPQFEKSGGGGGENLYFQGH)."
        }
      ],
      "buffer": {
        "name": "50 mM Tris, 300 mM NaCl, 5% glycerol",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 8.0,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Glutamine C‐methyltransferase without cobalamin from Methanoculleus thermophilus",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": "Soleil",
            "address": "Saint-Aubin, France",
            "full_name": "Soleil Synchrotron",
            "webpage": "http://www.synchrotron-soleil.fr/"
          }
        ],
        "contributor_name": "Aurélien",
        "contributor_surname": "Thureau",
        "orcid": null
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2024-09-18",
    "storage_temperature": 6.0,
    "cell_temperature": 20.0,
    "exposure_time": 0.99,
    "number_of_frames": 646,
    "wavelength": 0.1033,
    "sample_detector_distance": 2.0,
    "concentration_min": null,
    "concentration_max": 5.0,
    "sample_volume": 50.0,
    "flow_rate": 0.25,
    "s_min": 0.036,
    "s_max": 5.0,
    "total_exposure_time": null,
    "seccolumn": 46
  },
  "fits": [
    {
      "models": [
        {
          "model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDVY7_fit1_model1_img.png",
          "software": "AlphaFold",
          "pdb_link": [],
          "model_title": null,
          "type_of_model": "atomic",
          "software_version": null,
          "model_data": "https://www.sasbdb.org/media/pdb_file/SASDVY7_fit1_model1.pdb",
          "model_mw": 53.08,
          "bead_radius": null,
          "log": null,
          "symmetry": null,
          "comment": null,
          "user": 91
        }
      ],
      "fit_unit": "1/A",
      "fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDVY7_fit1_fixed_fit_img.png",
      "software": "CRYSOL",
      "chi_square_value": 1.371,
      "p_value": 0.0,
      "fit_residual_plot": "SASDVY7_fit1_fitresiduals_img.png",
      "fit_data": "https://www.sasbdb.org/media/fitting_files/SASDVY7_fit1.fit",
      "fit_log": null,
      "software_version": null,
      "description": ""
    }
  ],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": null,
  "i0_calibration_standard": null,
  "description": null,
  "experiment_description": "Synchrotron SAXS data from solutions of glutamine C‐methyltransferase without cobalamin in 50 mM Tris, 300 mM NaCl, 5% glycerol, pH 8 were collected on the SWING beam line at SOLEIL (Saint-Aubin, France) using a Eiger 4M detector at a sample-detector distance of 2 m and at a wavelength of λ = 0.1033 nm (I(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). In-line size-exclusion chromatography (SEC) SAS was employed. The SEC parameters were as follows: A 50.00 μl sample at 5 mg/ml was injected at a 0.25 ml/min flow rate onto a Cytiva Superdex 200 5/150 column at 20°C. 646 successive 0.990 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
  "tags": [],
  "intensity_unit": "arbitrary",
  "experimental_mw": 50.3,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": 53.0,
  "porod_mw_error": null,
  "pddf_i0": 0.0221,
  "pddf_i0_error": null,
  "guinier_i0": 0.0220185,
  "guinier_i0_error": null,
  "pddf_rg": 2.67,
  "pddf_rg_error": null,
  "guinier_rg": 2.625,
  "guinier_rg_error": 0.086,
  "pddf_dmax": 10.4,
  "pddf_dmax_error": null,
  "porod_volume": 85.0,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 11,
  "guinier_point_last": 83,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDVY7_fit1_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2026-05-27T09:45:48.001805+02:00",
  "bragg_peak": []
}

{
  "code": "SASDVY7",
  "status": "success",
  "started_at": "2026-08-11T15:42:56.216377+00:00",
  "finished_at": "2026-08-11T15:43:04.502801+00:00",
  "source_last_modified": "2026-05-27T09:45:48.001805+02:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDVY7/",
      "path": "/data/saxsdb/sasbdb/entries/y7/sasdvy7/source/summary.json",
      "size": 8287,
      "sha256": "2eaa40128187b7c8df1b68dcac8bd17ad799a2e42d8e606121e2dc2fafeeae54"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDVY7_fit1.dat",
      "path": "/data/saxsdb/sasbdb/entries/y7/sasdvy7/source/SASDVY7.dat",
      "size": 50232,
      "sha256": "2c991f75bb5cb013d8dcbf42b4d1049a40cce418b0528eb721159476f33092f1",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDVY7.out",
      "path": "/data/saxsdb/sasbdb/entries/y7/sasdvy7/source/SASDVY7.out",
      "size": 107616,
      "sha256": "32c099bf6aa21efe1afb82a7f9c724aaaeea3de643d04df217129f1c42beef95",
      "role": "pddf"
    },
    {
      "status": "not_available",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDVY7.sascif",
      "path": "/data/saxsdb/sasbdb/entries/y7/sasdvy7/source/SASDVY7.sascif",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDVY7.zip",
      "path": "/data/saxsdb/sasbdb/entries/y7/sasdvy7/source/SASDVY7.zip",
      "size": 127002,
      "sha256": "7c61951595f53f3c06a0043ef3cf9ea36f70d32e01d9ec8a595bf819f980ac3b",
      "role": "full_entry_zip",
      "zip_member_count": 4,
      "zip_validation": "central_directory_readable"
    }
  ]
}