Aromatic-L-amino-acid decarboxylase R347Q bound to pyridoxal 5'-phosphate (PLP)

{
  "code": "SASDW84",
  "status": "Published",
  "type_of_curve": "Co-flow batch",
  "angular_unit": "1/nm",
  "project": {
    "title": "The CRISPR-Cas9 knockout DDC SH-SY5Y in vitro model for AADC deficiency provides insight into the pathogenicity of R347Q and L353P variants: a cross-sectional structural and functional analysis.",
    "publication": {
      "title": "The CRISPR-Cas9 knockout DDC SH-SY5Y in vitro model for AADC deficiency provides insight into the pathogenicity of R347Q and L353P variants: a cross-sectional structural and functional analysis.",
      "author_list": "Carmona-Carmona CA, Bisello G, Franchini R, Lunardi G, Galavotti R, Perduca M, Ribeiro RP, Belviso BD, Giorgetti A, Caliandro R, Lievens PM, Bertoldi M",
      "journal": "FEBS J",
      "doi": "10.1111/febs.70120",
      "pmid": "40318155",
      "published_date": "2025 May 3"
    },
    "status": "released",
    "submitted_date": "2024-12-20",
    "released_date": "2025-04-02"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDW84.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDW84.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDW84_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDW84_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDW84_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDW84_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDW84.sascif",
  "experiment": {
    "instrument": {
      "detector": {
        "type": null,
        "name": "Pilatus3 2M",
        "resolution": 0.172
      },
      "name": "ESRF",
      "city": "Grenoble",
      "country": "France",
      "beamline_name": "BM29",
      "beam_geometry": "point",
      "type_of_source": "X-ray synchrotron",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Aromatic-L-amino-acid decarboxylase (R347Q)",
          "short_name": "AADC",
          "sequence": "MNASEFRRRGKEMVDYMANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFEDIINDV\r\nEKIIMPGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMD\r\nWLGKMLELPKAFLNEKAGEGGGVIQGSASEATLVALLAARTKVIHRLQAASPELTQAAIM\r\nEKLVAYSSDQAHSSVERAGLIGGVKLKAIPSDGNFAMRASALQEALERDKAAGLIPFFMV\r\nATLGTTTCCSFDNLLEVGPICNKEDIWLHVDAAYAGSAFICPEFRHLLNGVEFADSFNFN\r\nPHKWLLVNFDCSAMWVKKRTDLTGAFRLDPTYLKHSHQDSGLITDYQHWQIPLGRRFRSL\r\nKMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFEICVEVILGLVCFRLKGSNKVN\r\nEALLQRINSAKKIHLVPCHLRDKFVLRFAICSRTVESAHVQRAWEHIKELAADVLRAERE",
          "organism": "Homo sapiens",
          "uniprot_code": "P20711",
          "uniprot_range_first": 1,
          "uniprot_range_last": 478,
          "oligomerization": "dimer",
          "molecular_type": "protein",
          "uniprot_sequence": "MNASEFRRRGKEMVDYMANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFEDIINDV\nEKIIMPGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMD\nWLGKMLELPKAFLNEKAGEGGGVIQGSASEATLVALLAARTKVIHRLQAASPELTQAAIM\nEKLVAYSSDQAHSSVERAGLIGGVKLKAIPSDGNFAMRASALQEALERDKAAGLIPFFMV\nATLGTTTCCSFDNLLEVGPICNKEDIWLHVDAAYAGSAFICPEFRHLLNGVEFADSFNFN\nPHKWLLVNFDCSAMWVKKRTDLTGAFRLDPTYLKHSHQDSGLITDYRHWQIPLGRRFRSL\nKMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFEICVEVILGLVCFRLKGSNKVN\nEALLQRINSAKKIHLVPCHLRDKFVLRFAICSRTVESAHVQRAWEHIKELAADVLRAERE",
          "mw": 53.898,
          "total_mw": 107.796,
          "number_molecules": 1,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": ""
        }
      ],
      "buffer": {
        "name": "50 mM HEPES, 100 µM pyridoxal 5'-phosphate",
        "concentration_unit": null,
        "comment": null,
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 7.4,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Aromatic-L-amino-acid decarboxylase R347Q bound to pyridoxal 5'-phosphate (PLP)",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": null,
            "address": null,
            "full_name": "National Research Council",
            "webpage": null
          }
        ],
        "contributor_name": "Benny Danilo",
        "contributor_surname": "Belviso",
        "orcid": "https://orcid.org/0000-0003-2880-1064"
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2021-07-07",
    "storage_temperature": 4.0,
    "cell_temperature": 4.0,
    "exposure_time": 5.0,
    "number_of_frames": 4,
    "wavelength": 0.1,
    "sample_detector_distance": 2.867,
    "concentration_min": 5.37,
    "concentration_max": 5.37,
    "sample_volume": 50.0,
    "flow_rate": 0.16,
    "s_min": 0.041,
    "s_max": 5.174,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [
    {
      "models": [
        {
          "model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDW84_fit1_model1_img.png",
          "software": "DAMMIN",
          "pdb_link": [],
          "model_title": null,
          "type_of_model": "dummy",
          "software_version": "3.0.2",
          "model_data": "https://www.sasbdb.org/media/pdb_file/SASDW84_fit1_model1.pdb",
          "model_mw": 107.27,
          "bead_radius": 3.5,
          "log": "https://www.sasbdb.org/media/log_files/dammin_P1_refinement_AFfcoi5.log",
          "symmetry": null,
          "comment": null,
          "user": 930
        }
      ],
      "fit_unit": "1/A",
      "fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDW84_fit1_fixed_fit_img.png",
      "software": "DAMMIN",
      "chi_square_value": 1.14,
      "p_value": 0.1689,
      "fit_residual_plot": "SASDW84_fit1_fitresiduals_img.png",
      "fit_data": "https://www.sasbdb.org/media/fitting_files/SASDW84_fit1.fir",
      "fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/dammin_P1_refinement_YfauvID.log",
      "software_version": "3.0.2",
      "description": ""
    }
  ],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": "5.0",
  "i0_calibration_standard": null,
  "description": "Pyridoxal 5'-phosphate: https://www.ebi.ac.uk/chebi/searchId.do?chebiId=CHEBI:18405. CAUTION: Potentially aggregated.",
  "experiment_description": "Synchrotron SAXS data from solutions of aromatic-L-amino-acid decarboxylase (R347Q) bound to pyridoxal 5'-phosphate in 50 mM HEPES, 100 µM pyridoxal 5'-phosphate, pH 7.4 were collected on the BM29 beam line at the ESRF (Grenoble, France) using a Pilatus3 2M detector at a sample-detector distance of 2.9 m and at a wavelength of λ = 0.1 nm (I(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). Solute concentrations ranging between 5.4 and 5.4 mg/ml were measured at 4°C. Four successive 5 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
  "tags": [],
  "intensity_unit": "arbitrary",
  "experimental_mw": 114.0,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": 151.432,
  "porod_mw_error": null,
  "pddf_i0": 548.1,
  "pddf_i0_error": null,
  "guinier_i0": 564.768,
  "guinier_i0_error": null,
  "pddf_rg": 3.589,
  "pddf_rg_error": null,
  "guinier_rg": 3.6,
  "guinier_rg_error": 0.02,
  "pddf_dmax": 14.15,
  "pddf_dmax_error": null,
  "porod_volume": 219.98,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 37,
  "guinier_point_last": 54,
  "pddf_point_first": null,
  "pddf_point_last": null,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDW84_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2025-05-08T08:55:24.409452+02:00",
  "bragg_peak": []
}

{
  "code": "SASDW84",
  "status": "success",
  "started_at": "2026-08-11T14:16:22.945851+00:00",
  "finished_at": "2026-08-11T14:16:30.519610+00:00",
  "source_last_modified": "2025-05-08T08:55:24.409452+02:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDW84/",
      "path": "/data/saxsdb/sasbdb/entries/84/sasdw84/source/summary.json",
      "size": 8481,
      "sha256": "4f02cad975d4d4da54000f462fbd319c219e4a6fb7e53551c4aa8c910124ecfe"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDW84.dat",
      "path": "/data/saxsdb/sasbdb/entries/84/sasdw84/source/SASDW84.dat",
      "size": 45981,
      "sha256": "bb59c5dd0b625593799c240864fd5c9086e9688ba6d948411917b48e0e32d70a",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDW84.out",
      "path": "/data/saxsdb/sasbdb/entries/84/sasdw84/source/SASDW84.out",
      "size": 43534,
      "sha256": "e8702c697bb13ccbed5512cc1450ff26d09c8f476fa408af07107aa54559b1a5",
      "role": "pddf"
    },
    {
      "status": "not_available",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDW84.sascif",
      "path": "/data/saxsdb/sasbdb/entries/84/sasdw84/source/SASDW84.sascif",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDW84.zip",
      "path": "/data/saxsdb/sasbdb/entries/84/sasdw84/source/SASDW84.zip",
      "size": 40044,
      "sha256": "5344c6323257e8f6fe5947005b3f46a3c16853604b866dba94b69718c9281d5d",
      "role": "full_entry_zip",
      "zip_member_count": 4,
      "zip_validation": "central_directory_readable"
    }
  ]
}