The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDWG9",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/A",
"project": {
"title": "A class III ligand oscillates between internal and terminal binding modes as it engages with the Dishevelled PDZ domain.",
"publication": {
"title": "A class III ligand oscillates between internal and terminal binding modes as it engages with the Dishevelled PDZ domain.",
"author_list": "Kumar J, Micka M, Komárek J, Klumpler T, Bystrý V, Sprangers R, Bařinka C, Bryja V, Tripsianes K",
"journal": "Structure",
"doi": "10.1016/j.str.2025.05.012",
"pmid": "40516532",
"published_date": "2025 Jun 5"
},
"status": "released",
"submitted_date": "2025-02-25",
"released_date": "2025-06-17"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDWG9.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDWG9.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDWG9_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDWG9_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDWG9_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDWG9_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDWG9.sascif",
"experiment": {
"instrument": {
"detector": {
"type": "Hybrid Photon Counting (HPC) X-ray detector",
"name": "Rigaku HyPix-3000",
"resolution": 100.0
},
"name": "CEITEC",
"city": "Brno",
"country": "Czech Republic",
"beamline_name": "Rigaku BioSAXS-2000",
"beam_geometry": null,
"type_of_source": "X-ray in house",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Segment polarity protein dishevelled homolog DVL-3",
"short_name": "DLV3_PDZ",
"sequence": "GAMALNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDMLLQVNEINFENMSNDDAVRVLREIVHKPGPITLTVAKCWDPSPRGCFTLPRSE",
"organism": "Homo sapiens",
"uniprot_code": "Q92997",
"uniprot_range_first": 245,
"uniprot_range_last": 351,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MGETKIIYHLDGQETPYLVKLPLPAERVTLADFKGVLQRPSYKFFFKSMDDDFGVVKEEI\nSDDNAKLPCFNGRVVSWLVSAEGSHPDPAPFCADNPSELPPPMERTGGIGDSRPPSFHPH\nAGGGSQENLDNDTETDSLVSAQRERPRRRDGPEHATRLNGTAKGERRREPGGYDSSSTLM\nSSELETTSFFDSDEDDSTSRFSSSTEQSSASRLMRRHKRRRRKQKVSRIERSSSFSSITD\nSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDMLL\nQVNEINFENMSNDDAVRVLREIVHKPGPITLTVAKCWDPSPRGCFTLPRSEPIRPIDPAA\nWVSHTAAMTGTFPAYGMSPSLSTITSTSSSITSSIPDTERLDDFHLSIHSDMAAIVKAMA\nSPESGLEVRDRMWLKITIPNAFIGSDVVDWLYHNVEGFTDRREARKYASNLLKAGFIRHT\nVNKITFSEQCYYIFGDLCGNMANLSLHDHDGSSGASDQDTLAPLPHPGAAPWPMAFPYQY\nPPPPHPYNPHPGFPELGYSYGGGSASSQHSEGSRSSGSNRSGSDRRKEKDPKAGDSKSGG\nSGSESDHTTRSSLRGPRERAPSERSGPAASEHSHRSHHSLASSLRSHHTHPSYGPPGVPP\nLYGPPMLMMPPPPAAMGPPGAPPGRDLASVPPELTASRQSFRMAMGNPSEFFVDVM",
"mw": 11.978,
"total_mw": 11.978,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": "PDZ domain of the Segment polarity protein dishevelled homolog DVL-3. The protein construct used for SAXS contains an additional four non-native amino acids at the N-terminus (GAMA)."
}
],
"buffer": {
"name": "50 mM sodium phosphate, 50 mM NaCl, 0.5 mM EDTA",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 6.5,
"deuteration": null
},
"purity_method": null,
"name": "PDZ domain of the segment polarity protein dishevelled homolog DVL-3",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": null,
"full_name": "CEITEC - Central European Institute of Technology, Masaryk University",
"webpage": "https://www.ceitec.eu/"
}
],
"contributor_name": "Tomas",
"contributor_surname": "Klumpler",
"orcid": null
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2021-01-27",
"storage_temperature": 4.0,
"cell_temperature": 25.0,
"exposure_time": 600.0,
"number_of_frames": 6,
"wavelength": 0.154,
"sample_detector_distance": 0.48,
"concentration_min": null,
"concentration_max": 5.0,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.123,
"s_max": 4.002,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDWG9_fit1_model1_img.png",
"software": "REFMAC",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": "5.8.0258",
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDWG9_fit1_model1.pdb",
"model_mw": 11.77,
"bead_radius": null,
"log": null,
"symmetry": null,
"comment": null,
"user": 195
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDWG9_fit1_fixed_fit_img.png",
"software": "CRYSOL",
"chi_square_value": 0.989,
"p_value": 0.0321,
"fit_residual_plot": "SASDWG9_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDWG9_fit1.fit",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/DVL3_PDZext_C8_chainA00.log",
"software_version": "ATSAS 2.8.3",
"description": ""
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": null,
"experiment_description": "SAXS data from solutions of PDZ domain of the segment polarity protein dishevelled homolog DVL-3 in 50 mM sodium phosphate, 50 mM NaCl, 0.5 mM EDTA, pH 6.5 were collected using a Rigaku BioSAXS-2000 instrument at CEITEC (Brno, Czech Republic) equipped with a Rigaku HyPix-3000 detector at a sample-detector distance of 0.5 m and at a wavelength of λ = 0.154 nm (I(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). One solute concentration of 5.00 mg/ml was measured at 25°C. Six successive 600 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 10.4,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 12.6,
"porod_mw_error": null,
"pddf_i0": 0.7841,
"pddf_i0_error": null,
"guinier_i0": 0.79546,
"guinier_i0_error": null,
"pddf_rg": 1.57,
"pddf_rg_error": null,
"guinier_rg": 1.609,
"guinier_rg_error": 0.14,
"pddf_dmax": 4.31,
"pddf_dmax_error": null,
"porod_volume": 20.2,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 1,
"guinier_point_last": 48,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDWG9_datloglog_img.png",
"symmetry": null,
"last_modified": "2025-06-17T09:21:01.066938+02:00",
"bragg_peak": []
}View the complete manifest.json source
{
"code": "SASDWG9",
"status": "success",
"started_at": "2026-08-11T16:14:47.242562+00:00",
"finished_at": "2026-08-11T16:14:54.185250+00:00",
"source_last_modified": "2025-06-17T09:21:01.066938+02:00",
"files": [
{
"status": "downloaded",
"url": "https://www.sasbdb.org/rest-api/entry/summary/SASDWG9/",
"path": "/data/saxsdb/sasbdb/entries/g9/sasdwg9/source/summary.json",
"size": 8237,
"sha256": "4c7c244920e8d748f2dbd6e99317fd2ee0aab2fbe3da724b82bc0330b4502840"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/intensities_files/SASDWG9.dat",
"path": "/data/saxsdb/sasbdb/entries/g9/sasdwg9/source/SASDWG9.dat",
"size": 8234,
"sha256": "47b1df1003210aa18f302e2a95f58a73ee92875dc7e788fe356a8eab191cc32f",
"role": "curve"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/p_of_R_files/SASDWG9.out",
"path": "/data/saxsdb/sasbdb/entries/g9/sasdwg9/source/SASDWG9.out",
"size": 28552,
"sha256": "7a79fab7e65c92914c92dd8ed8621f84c22a5cf2670d6c2509d9bcaadd7c8d09",
"role": "pddf"
},
{
"status": "not_available",
"url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDWG9.sascif",
"path": "/data/saxsdb/sasbdb/entries/g9/sasdwg9/source/SASDWG9.sascif",
"role": "sascif"
},
{
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDWG9.zip",
"path": "/data/saxsdb/sasbdb/entries/g9/sasdwg9/source/SASDWG9.zip",
"size": 54225,
"sha256": "51e319b0bc13669638031aaab358d369b1d52a94affb64896f86c94c44ea67aa",
"role": "full_entry_zip",
"zip_member_count": 4,
"zip_validation": "central_directory_readable"
}
]
}
