The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDWU6",
"status": "Published",
"type_of_curve": "SEC-SAS",
"angular_unit": "1/A",
"project": {
"title": "A structural basis for chaperone repression of stress signaling from the endoplasmic reticulum.",
"publication": {
"title": "A structural basis for chaperone repression of stress signaling from the endoplasmic reticulum.",
"author_list": "Neidhardt L, Tung J, Kuchersky M, Milczarek J, Kargas V, Stott K, Rosenzweig R, Ron D, Yan Y",
"journal": "Mol Cell",
"doi": "10.1016/j.molcel.2025.09.032",
"pmid": "41135511",
"published_date": "2025 Oct 23"
},
"status": "released",
"submitted_date": "2025-01-24",
"released_date": "2025-10-23"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDWU6.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDWU6.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDWU6_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDWU6_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDWU6_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDWU6_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDWU6.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Eiger 4M",
"resolution": 75.0
},
"name": "Diamond Light Source",
"city": "Didcot",
"country": "UK",
"beamline_name": "B21",
"beam_geometry": null,
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Anterior gradient protein 2 homolog",
"short_name": "AGR2",
"sequence": "PQTLSRGWGDQLIWTQTYEEALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSPDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLL",
"organism": "Homo sapiens",
"uniprot_code": "O95994",
"uniprot_range_first": 41,
"uniprot_range_last": 171,
"oligomerization": "dimer",
"molecular_type": "protein",
"uniprot_sequence": "MEKIPVSAFLLLVALSYTLARDTTVKPGAKKDTKDSRPKLPQTLSRGWGDQLIWTQTYEE\nALYKSKTSNKPLMIIHHLDECPHSQALKKVFAENKEIQKLAEQFVLLNLVYETTDKHLSP\nDGQYVPRIMFVDPSLTVRADITGRYSNRLYAYEPADTALLLDNMKKALKLLKTEL",
"mw": 15.122,
"total_mw": 30.244,
"number_molecules": 2,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": "Required for MUC2 post-transcriptional synthesis and secretion."
}
],
"buffer": {
"name": "20 mM Tris pH7.4, 150 mM NaCl, 1% glycerol, 0.2 mM TCEP",
"concentration_unit": null,
"comment": "The buffer for SEC runs was the same as the sample buffer.",
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.4,
"deuteration": null
},
"purity_method": null,
"name": "Human anterior gradient protein 2 (AGR2)",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": null,
"full_name": "University of Cambridge",
"webpage": null
}
],
"contributor_name": "Yahui",
"contributor_surname": "Yan",
"orcid": "https://orcid.org/0000-0001-6934-9874"
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2024-05-05",
"storage_temperature": 15.0,
"cell_temperature": 15.0,
"exposure_time": 1.0,
"number_of_frames": 30,
"wavelength": 0.09464,
"sample_detector_distance": 3.6929,
"concentration_min": null,
"concentration_max": 46.0,
"sample_volume": 35.0,
"flow_rate": 0.06,
"s_min": 0.045,
"s_max": 3.4,
"total_exposure_time": null,
"seccolumn": 13
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDWU6_fit1_model1_img.png",
"software": "MultiFoXS",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDWU6_fit1_model1.pdb",
"model_mw": 30.03,
"bead_radius": null,
"log": null,
"symmetry": null,
"comment": null,
"user": 1180
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDWU6_fit1_model2_img.png",
"software": "MultiFoXS",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDWU6_fit1_model2.pdb",
"model_mw": 15.02,
"bead_radius": null,
"log": null,
"symmetry": null,
"comment": null,
"user": 1180
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDWU6_fit1_fitfoxs_img.png",
"software": "MultiFoXS",
"chi_square_value": 4.229369,
"p_value": 0.0,
"fit_residual_plot": "SASDWU6_fit1_fitfoxsresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDWU6_fit1.dat",
"fit_log": null,
"software_version": null,
"description": ""
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": null,
"experiment_description": "Synchrotron SAXS data from solutions of anterior gradient protein 2 (AGR2) in 20 mM Tris pH7.4, 150 mM NaCl, 1% glycerol, 0.2 mM TCEP, were collected on the B21 beam line at the Diamond Light Source (Didcot, UK) using a Eiger 4M detector at a sample-detector distance of 3.7 m and at a wavelength of λ = 0.09464 nm (I(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). In-line size-exclusion chromatography (SEC) SAS was employed. The SEC parameters were as follows: A 35.00 μl sample at 46 mg/ml was injected at a 0.06 ml/min flow rate onto a GE Superdex 75 Increase 3.2/300 column at 15°C. 30 successive 1 second frames were collected through the sample elution peak (from a total of 600 frames collected throughout the entire SEC run). The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
"tags": [],
"intensity_unit": "1/cm",
"experimental_mw": 24.4,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 18.7,
"porod_mw_error": null,
"pddf_i0": 0.1785,
"pddf_i0_error": null,
"guinier_i0": 0.177626,
"guinier_i0_error": null,
"pddf_rg": 1.98,
"pddf_rg_error": 0.018,
"guinier_rg": 1.955,
"guinier_rg_error": 0.011,
"pddf_dmax": 6.27,
"pddf_dmax_error": null,
"porod_volume": 29.9,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 224,
"guinier_point_last": 473,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDWU6_datloglog_img.png",
"symmetry": null,
"last_modified": "2025-10-27T12:08:22.283589+01:00",
"bragg_peak": []
}
