The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
full_entry_zip：source record and ZIP contents (11 items)
{
"path": "/data/saxsdb/sasbdb/entries/42/sasdx42/source/SASDX42.zip",
"role": "full_entry_zip",
"sha256": "b32a8840f5c57b0c830d54a7b467431ed352e02f4f532f6a6ac2154bacb25a7f",
"size": 1656403,
"status": "downloaded",
"url": "https://www.sasbdb.org/media/zip_directories/SASDX42.zip",
"zip_member_count": 11,
"zip_members": [
{
"crc32": "392727ff",
"name": "SASDX42/experimental_data/SASDX42.dat",
"size": 47210
},
{
"crc32": "bd23ba7b",
"name": "SASDX42/pddf/SASDX42.out",
"size": 47990
},
{
"crc32": "32fcbe47",
"name": "SASDX42/SASDX42_fit1.fit",
"size": 28266
},
{
"crc32": "b7080d52",
"name": "SASDX42/SASDX42_fit1_model1.cif",
"size": 655003
},
{
"crc32": "6818d2f9",
"name": "SASDX42/SASDX42_fit1_model2.cif",
"size": 655291
},
{
"crc32": "c44d2843",
"name": "SASDX42/SASDX42_fit1_model3.cif",
"size": 653346
},
{
"crc32": "fd0ee594",
"name": "SASDX42/SASDX42_fit1_model4.cif",
"size": 652428
},
{
"crc32": "801a4880",
"name": "SASDX42/SASDX42_fit1_model5.cif",
"size": 653992
},
{
"crc32": "1e6f413f",
"name": "SASDX42/SASDX42_fit1_rg_distribution.txt",
"size": 2442
},
{
"crc32": "420853db",
"name": "SASDX42/additional_files/SASDX42_EOM_output.zip",
"size": 774313
},
{
"crc32": "9cf98e4b",
"name": "SASDX42/additional_files/README.txt",
"size": 110
}
],
"zip_validation": "central_directory_readable"
}Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDX42",
"status": "Published",
"type_of_curve": "Single concentration",
"angular_unit": "1/nm",
"project": {
"title": "Biochemical and structural characterization of the human gut microbiome metallopeptidase IgAse provides insight into its unique specificity for the Fab' region of IgA1 and IgA2.",
"publication": {
"title": "Biochemical and structural characterization of the human gut microbiome metallopeptidase IgAse provides insight into its unique specificity for the Fab' region of IgA1 and IgA2.",
"author_list": "Ramírez-Larrota JS, Juyoux P, Guerra P, Eckhard U, Gomis-Rüth FX",
"journal": "PLoS Pathog",
"doi": "10.1371/journal.ppat.1013292",
"pmid": "40627637",
"published_date": "2025 Jul"
},
"status": "released",
"submitted_date": "2025-02-27",
"released_date": "2025-06-18"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDX42.out",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDX42.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDX42_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDX42_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDX42_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDX42_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDX42.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Pilatus3 2M",
"resolution": 0.172
},
"name": "ESRF",
"city": "Grenoble",
"country": "France",
"beamline_name": "BM29",
"beam_geometry": "point",
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "IgA protease (E540A)",
"short_name": "IgAse",
"sequence": "MASKPDIKVGDYVKMGVYNNASILWRCVSIDNNGPLMLADKIVDTLAYDAKTNDNSNSKSHSRSYKRDDY\r\nGSNYWKDSNMRSWLNSTAAEGKVDWLCGNPPKDGYVSGVGAYNEKAGFLNAFSKSEIAAMKTVTQRSLVS\r\nHPEYNKGIVDGDANSDLLYYTDISEAVANYDSSYFETTTEKVFLLDVKQANAVWKNLKGYYVAYNNDGMA\r\nWPYWLRTPVTDCNHDMRYISSSGQVGRYAPWYSDLGVRPAFYLDSEYFVTTSGSGSQSSPYIGSAPNKQE\r\nDDYTISEPAEDANPDWNVSTEQSIQLTLGPWYSNDGKYSNPTIPVYTIQKTRSDTENMVVVVCGEGYTKS\r\nQQGKFINDVKRLWQDAMKYEPYRSYADRFNVYALCTASESTFDNGGSTFFDVIVDKYNSPVISNNLHGSQ\r\nWKNHIFERCIGPEFIEKIHDAHIKKKCDPNTIPSGSEYEPYYYVHDYIAQFAMVVNTKSDFGGAYNNREY\r\nGFHYFISPSDSYRASKTFAHAFGHGLLGLGDEYSNGYLLDDKELKSLNLSSVEDPEKIKWRQLLGFRNTY\r\nTCRNAYGSKMLVSSYECIMRDTNYQFCEVCRLQGFKRMSQLVKDVDLYVATPEVKEYTGAYSKPSDFTDL\r\nETSSYYNYTYNRNDRLLSGNSKSRFNTNMNGKKIELRTVIQNISDKNARQLKFKMWIKHSDGSVATDSSG\r\nNPLQTVQTFDIPVWNDKANFWPLGALDHIKSDFNSGLKSCSLIYQIPSDAQLKSGDTVAFQVLDENGNVL\r\nADDNTETQRYTTVSIQYKFEDGSEIPNTAGGTFTVPYGTKLDLTPAKTLYDYEFIKVDGLNKPIVSDGTV\r\nVTYYYKNKNEEHTHNLTLVAAKAATCTTAGNSAYYTCDGCDKWFADATGSVEITDKTSVKIPAPGHTAGT\r\nEWKSDDTNHWHECTVAGCGVIIESTKSAHTAGEWIVDTPATATTAGTKHKECTVCHRVLETQPIPSTGTE\r\nLKIIAGDNQIYNKASGSDVTITCNGDFAKFTGIKVDGSVVDSSNYTAVSGSTVLTLKASYLGTLTDGSHT\r\nITFVYTDGEANANLTVRTAGSGHIHDYGTEWKSNADNHWHECNCGDKKDEAAHSFKWVVDKEATATKKGS\r\nKHEECKICGYKRSAVEILEHHHHHH",
"organism": "Thomasclavelia ramosa",
"uniprot_code": "Q9AES2",
"uniprot_range_first": 31,
"uniprot_range_last": 1166,
"oligomerization": "monomer",
"molecular_type": "protein",
"uniprot_sequence": "MTKKLMTKKITAIFLALYMAISVLPMTIQAASKPDIKVGDYVKMGVYNNASILWRCVSID\nNNGPLMLADKIVDTLAYDAKTNDNSNSKSHSRSYKRDDYGSNYWKDSNMRSWLNSTAAEG\nKVDWLCGNPPKDGYVSGVGAYNEKAGFLNAFSKSEIAAMKTVTQRSLVSHPEYNKGIVDG\nDANSDLLYYTDISEAVANYDSSYFETTTEKVFLLDVKQANAVWKNLKGYYVAYNNDGMAW\nPYWLRTPVTDCNHDMRYISSSGQVGRYAPWYSDLGVRPAFYLDSEYFVTTSGSGSQSSPY\nIGSAPNKQEDDYTISEPAEDANPDWNVSTEQSIQLTLGPWYSNDGKYSNPTIPVYTIQKT\nRSDTENMVVVVCGEGYTKSQQGKFINDVKRLWQDAMKYEPYRSYADRFNVYALCTASEST\nFDNGGSTFFDVIVDKYNSPVISNNLHGSQWKNHIFERCIGPEFIEKIHDAHIKKKCDPNT\nIPSGSEYEPYYYVHDYIAQFAMVVNTKSDFGGAYNNREYGFHYFISPSDSYRASKTFAHE\nFGHGLLGLGDEYSNGYLLDDKELKSLNLSSVEDPEKIKWRQLLGFRNTYTCRNAYGSKML\nVSSYECIMRDTNYQFCEVCRLQGFKRMSQLVKDVDLYVATPEVKEYTGAYSKPSDFTDLE\nTSSYYNYTYNRNDRLLSGNSKSRFNTNMNGKKIELRTVIQNISDKNARQLKFKMWIKHSD\nGSVATDSSGNPLQTVQTFDIPVWNDKANFWPLGALDHIKSDFNSGLKSCSLIYQIPSDAQ\nLKSGDTVAFQVLDENGNVLADDNTETQRYTTVSIQYKFEDGSEIPNTAGGTFTVPYGTKL\nDLTPAKTLYDYEFIKVDGLNKPIVSDGTVVTYYYKNKNEEHTHNLTLVAAKAATCTTAGN\nSAYYTCDGCDKWFADATGSVEITDKTSVKIPAPGHTAGTEWKSDDTNHWHECTVAGCGVI\nIESTKSAHTAGEWIVDTPATATTAGTKHKECTVCHRVLETQPIPSTGTELKIIAGDNQIY\nNKASGSDVTITCNGDFAKFTGIKVDGSVVDSSNYTAVSGSTVLTLKASYLGTLTDGSHTI\nTFVYTDGEANANLTVRTAGSGHIHDYGTEWKSNADNHWHECNCGDKKDEAAHSFKWVVDK\nEATATKKGSKHEECKICGYKRSAVEIPATGTSTAPTDTTKPNDTTKPGNTNGSEKSPQTG\nDNSNIFLWFALLFVSAAGVTGITAYNKKKKEHAE",
"mw": 127.857,
"total_mw": 127.857,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": "The protein construct used for SAXS contains an additional C-terminal polyhistidine tag (LEHHHHHH)."
}
],
"buffer": {
"name": "50 mM Tris, 150 mM NaCl",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 8.0,
"deuteration": null
},
"purity_method": null,
"name": "IgA peptidase (A31-I1166; active site mutant E540A)",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [
{
"affiliation": [
{
"short_name": null,
"address": null,
"full_name": "Molecular Biology Institute of Barcelona",
"webpage": null
}
],
"contributor_name": "Juan Sebastián",
"contributor_surname": "Ramírez Larrota",
"orcid": ""
}
],
"concentration_method": null,
"concentration_unit": null,
"date": "2023-05-23",
"storage_temperature": 4.0,
"cell_temperature": 20.0,
"exposure_time": 4.0,
"number_of_frames": 250,
"wavelength": 0.099,
"sample_detector_distance": 2.867,
"concentration_min": null,
"concentration_max": 4.0,
"sample_volume": null,
"flow_rate": null,
"s_min": 0.063,
"s_max": 5.21,
"total_exposure_time": null,
"seccolumn": null
},
"fits": [
{
"models": [
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDX42_fit1_model1_img.png",
"software": "EOM/RANCH",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDX42_fit1_model1.cif",
"model_mw": null,
"bead_radius": 1.9,
"log": null,
"symmetry": null,
"comment": "0.44 volume fraction",
"user": 1196
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDX42_fit1_model2_img.png",
"software": "EOM/RANCH",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDX42_fit1_model2.cif",
"model_mw": null,
"bead_radius": 1.9,
"log": null,
"symmetry": null,
"comment": "0.11 volume fraction",
"user": 1196
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDX42_fit1_model3_img.png",
"software": "EOM/RANCH",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDX42_fit1_model3.cif",
"model_mw": null,
"bead_radius": 1.9,
"log": null,
"symmetry": null,
"comment": "0.11 volume fraction",
"user": 1196
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDX42_fit1_model4_img.png",
"software": "EOM/RANCH",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDX42_fit1_model4.cif",
"model_mw": null,
"bead_radius": 1.9,
"log": null,
"symmetry": null,
"comment": "0.22 volume fraction",
"user": 1196
},
{
"model_plot": "https://www.sasbdb.org/media/pdb_file/images/SASDX42_fit1_model5_img.png",
"software": "EOM/RANCH",
"pdb_link": [],
"model_title": null,
"type_of_model": "atomic",
"software_version": null,
"model_data": "https://www.sasbdb.org/media/pdb_file/SASDX42_fit1_model5.cif",
"model_mw": null,
"bead_radius": 1.9,
"log": null,
"symmetry": null,
"comment": "0.11 volume fraction",
"user": 1196
}
],
"fit_unit": "1/A",
"fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDX42_fit1_fixed_fit_img.png",
"software": "EOM/GAJOE",
"chi_square_value": 1.541,
"p_value": 0.0139,
"fit_residual_plot": "SASDX42_fit1_fitresiduals_img.png",
"fit_data": "https://www.sasbdb.org/media/fitting_files/SASDX42_fit1.fit",
"fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/logFile_001_1_9MVb3vS.log",
"software_version": "2.1",
"description": ""
}
],
"estimated_volume_method": null,
"pddf_software": "ATSAS GNOM",
"pddf_software_version": "5.0",
"i0_calibration_standard": null,
"description": "The results obtained from EOM analysis are made available in the full entry zip archive.",
"experiment_description": "Synchrotron SAXS data from solutions of IgA peptidase in 50 mM Tris, 150 mM NaCl, pH 8 were collected on the BM29 beam line at the ESRF (Grenoble, France) using a Pilatus3 2M detector at a sample-detector distance of 2.9 m and at a wavelength of λ = 0.099 nm (I(s) vs s, where s = 4πsinθ/λ, and 2θ is the scattering angle). One solute concentration of 4.00 mg/ml was measured at 20°C. 250 successive 4 second frames were collected. The data were normalized to the intensity of the transmitted beam and radially averaged; the scattering of the solvent-blank was subtracted.",
"tags": [],
"intensity_unit": "arbitrary",
"experimental_mw": 118.8,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": 119.0,
"porod_mw_error": null,
"pddf_i0": 72.97,
"pddf_i0_error": null,
"guinier_i0": 70.169,
"guinier_i0_error": null,
"pddf_rg": 6.433,
"pddf_rg_error": null,
"guinier_rg": 5.65,
"guinier_rg_error": 0.035,
"pddf_dmax": 27.9,
"pddf_dmax_error": null,
"porod_volume": 190.0,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 6,
"guinier_point_last": 33,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDX42_datloglog_img.png",
"symmetry": null,
"last_modified": "2025-07-21T18:12:24.155654+02:00",
"bragg_peak": []
}
