The following content comes directly from the SASBDB entry. Missing values are shown as “—”; SAXSdb does not infer undeclared units.
Every source field is expanded here, including empty values, list members and fields already shown above.
View the complete summary.json source
{
"code": "SASDX83",
"status": "Published",
"type_of_curve": "SEC-SAS",
"angular_unit": "1/A",
"project": {
"title": "Trypanosome histone variants H3.V and H4.V promote nucleosome plasticity in repressed chromatin",
"publication": null,
"status": "released",
"submitted_date": "2025-04-02",
"released_date": "2026-01-22"
},
"pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDX83.dat",
"intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDX83.dat",
"intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDX83_dat_img.png",
"intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDX83_kratky_img.png",
"pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDX83_pofr_img.png",
"intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDX83_guinier_img.png",
"sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDX83.sascif",
"experiment": {
"instrument": {
"detector": {
"type": null,
"name": "Eiger 4M",
"resolution": 75.0
},
"name": "Diamond Light Source",
"city": "Didcot",
"country": "UK",
"beamline_name": "B21",
"beam_geometry": null,
"type_of_source": "X-ray synchrotron",
"point_source": null,
"line_collimation": null,
"sample_path_length": null,
"line_collimation_slitlength": null,
"line_collimation_integrationwidth": null,
"xray_energy": null,
"beam_profile_ah": null,
"beam_profile_al": null
},
"sample": {
"molecule": [
{
"long_name": "Histone H2A",
"short_name": "H2A",
"sequence": "MATPKQAVKKASKGGSSRSVKAGLIFPVGRVGTLLRRGQYARRIGASGAVYMAAVLEYLTAELLELSVKAAAQQTKKTKRLTPRTVTLAVRHDDDLGALLRNVTMSRGGVMPSLNKALAKKQKSGKHAKATPSV",
"organism": "Trypanosoma brucei brucei (strain 927/4 GUTat10.1)",
"uniprot_code": "Q57YA3",
"uniprot_range_first": 2,
"uniprot_range_last": 134,
"oligomerization": "other",
"molecular_type": "protein",
"uniprot_sequence": "MATPKQAVKKASKGGSSRSVKAGLIFPVGRVGTLLRRGQYARRIGASGAVYMAAVLEYLT\nAELLELSVKAAAQQTKKTKRLTPRTVTLAVRHDDDLGALLRNVTMSRGGVMPSLNKALAK\nKQKSGKHAKATPSV",
"mw": 14.212,
"total_mw": 28.424,
"number_molecules": 2,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": ""
},
{
"long_name": "Histone H2B",
"short_name": "H2B",
"sequence": "ATPKSTPAKTRKEAKKTRRQRKRTWNVYVSRSLRSINSQMSMTSRTMKIVNSFVNDLFERIAAEAATIVRVNRKRTLGARELQTAVRLVLPADLAKHAMAEGTKAVSHASS",
"organism": "Trypanosoma brucei brucei (strain 927/4 GUTat10.1)",
"uniprot_code": "Q389T1",
"uniprot_range_first": 2,
"uniprot_range_last": 112,
"oligomerization": "other",
"molecular_type": "protein",
"uniprot_sequence": "MATPKSTPAKTRKEAKKTRRQRKRTWNVYVSRSLRSINSQMSMTSRTMKIVNSFVNDLFE\nRIAAEAATIVRVNRKRTLGARELQTAVRLVLPADLAKHAMAEGTKAVSHASS",
"mw": 12.438,
"total_mw": 24.876,
"number_molecules": 2,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": ""
},
{
"long_name": "Histone H3, putative",
"short_name": "H3",
"sequence": "SRTKETARTKKTITSKKSKKASKGSDAASGVKTAQRRWRPGTVALREIRQFQRSTDLLLQKAPFQRLVREVSGAQKEGLRFQSSAILAAQEATESYIVSLLADTNRACIHSGRVTIQPKDIHLALCLRGERA",
"organism": "Trypanosoma brucei brucei (strain 927/4 GUTat10.1)",
"uniprot_code": "Q4GYX7",
"uniprot_range_first": 2,
"uniprot_range_last": 133,
"oligomerization": "other",
"molecular_type": "protein",
"uniprot_sequence": "MSRTKETARTKKTITSKKSKKASKGSDAASGVKTAQRRWRPGTVALREIRQFQRSTDLLL\nQKAPFQRLVREVSGAQKEGLRFQSSAILAAQEATESYIVSLLADTNRACIHSGRVTIQPK\nDIHLALCLRGERA",
"mw": 14.619,
"total_mw": 29.238,
"number_molecules": 2,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": ""
},
{
"long_name": "Histone H4",
"short_name": "H4",
"sequence": "AKGKKSGEAKGSQKRQKKVLRENVRGITRGSIRRLARRGGVKRISGVIYDEVRGVLKSFVEGVVRDATAYTEYSRKKTVTAVDVVNALRKRGKILYGYA",
"organism": "Trypanosoma brucei brucei (strain 927/4 GUTat10.1)",
"uniprot_code": "Q57Z31",
"uniprot_range_first": 2,
"uniprot_range_last": 100,
"oligomerization": "other",
"molecular_type": "protein",
"uniprot_sequence": "MAKGKKSGEAKGSQKRQKKVLRENVRGITRGSIRRLARRGGVKRISGVIYDEVRGVLKSF\nVEGVVRDATAYTEYSRKKTVTAVDVVNALRKRGKILYGYA",
"mw": 11.011,
"total_mw": 22.022,
"number_molecules": 2,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": ""
},
{
"long_name": "Widom 601 145 bp DNA - strand 1",
"short_name": null,
"sequence": "ATCGATGTATATATCTGACACGTGCCTGGAGACTAGGGAGTAATCCCCTTGGCGGTTAAAACGCGGGGGACAGCGCGTACGTGCGTTTAAGCGGTGCTAGAGCTGTCTACGACCAATTGAGCGGCCTCGGCACCGGGATTCTGAT",
"organism": null,
"uniprot_code": null,
"uniprot_range_first": null,
"uniprot_range_last": null,
"oligomerization": "other",
"molecular_type": "DNA",
"uniprot_sequence": "",
"mw": 45.055,
"total_mw": 45.055,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": ""
},
{
"long_name": "Widom 601 145 bp DNA - strand 2",
"short_name": null,
"sequence": "ATCAGAATCCCGGTGCCGAGGCCGCTCAATTGGTCGTAGACAGCTCTAGCACCGCTTAAACGCACGTACGCGCTGTCCCCCGCGTTTTAACCGCCAAGGGGATTACTCCCTAGTCTCCAGGCACCTGTCAGATATATACATCGAT",
"organism": null,
"uniprot_code": null,
"uniprot_range_first": null,
"uniprot_range_last": null,
"oligomerization": "other",
"molecular_type": "DNA",
"uniprot_sequence": "",
"mw": 44.543,
"total_mw": 44.543,
"number_molecules": 1,
"complex_state": false,
"deuteration": null,
"molecule_source": "biological",
"molecule_description": ""
}
],
"buffer": {
"name": "20 mM HEPES, 150 mM NaCl, 1 mM DTT",
"concentration_unit": null,
"comment": null,
"additive": null,
"concentration": null,
"pka": null,
"ph": 7.5,
"deuteration": null
},
"purity_method": null,
"name": "T. brucei Canonical Nucleosome Core Particle",
"ext_coefficient": null,
"contrast": null,
"specific_vol": null,
"dry_vol": null,
"absorbption": null,
"deuteration": null,
"mixture": null
},
"contributor": [],
"concentration_method": null,
"concentration_unit": null,
"date": "2023-10-10",
"storage_temperature": 4.0,
"cell_temperature": 15.0,
"exposure_time": 3.0,
"number_of_frames": 600,
"wavelength": 0.09464,
"sample_detector_distance": 3.7212,
"concentration_min": null,
"concentration_max": 1.1,
"sample_volume": 50.0,
"flow_rate": 0.08,
"s_min": 0.045,
"s_max": 3.4,
"total_exposure_time": null,
"seccolumn": 14
},
"fits": [],
"estimated_volume_method": null,
"pddf_software": "ScÅtter",
"pddf_software_version": "IV",
"i0_calibration_standard": null,
"description": null,
"experiment_description": null,
"tags": [],
"intensity_unit": "1/cm",
"experimental_mw": 203.028,
"experimental_mw_error": null,
"guinier_i0_mw": null,
"guinier_i0_mw_error": null,
"porod_mw": null,
"porod_mw_error": null,
"pddf_i0": 0.0599,
"pddf_i0_error": null,
"guinier_i0": 0.0602744,
"guinier_i0_error": null,
"pddf_rg": 4.17,
"pddf_rg_error": null,
"guinier_rg": 4.262,
"guinier_rg_error": 0.066,
"pddf_dmax": 11.75,
"pddf_dmax_error": null,
"porod_volume": 435.41,
"porod_volume_error": null,
"estimated_volume": null,
"estimated_volume_error": null,
"guinier_point_first": 65,
"guinier_point_last": 200,
"pddf_point_first": null,
"pddf_point_last": null,
"i0_calibration_standard_data": null,
"intensities_log_log_plot": "SASDX83_datloglog_img.png",
"symmetry": null,
"last_modified": "2026-01-22T11:46:04.158592+01:00",
"bragg_peak": []
}
