Probable conserved Mce associated membrane protein (Mam1Adelta106) from M.tuberculosis (SANS)

{
  "code": "SASDXG2",
  "status": "Published",
  "type_of_curve": "Single concentration",
  "angular_unit": "1/A",
  "project": {
    "title": "Insight into the structure and interactions of the <i>M. tuberculosis</i>\n            Mce-associated membrane proteins Mam1A-1D",
    "publication": {
      "title": "Insight into the structure and interactions of the <i>M. tuberculosis</i>\n            Mce-associated membrane proteins Mam1A-1D",
      "author_list": "Hynönen M, Perumal P, Hynönen N, Doutch J, Ma K, Venkatesan R",
      "journal": null,
      "doi": "10.1101/2025.03.26.645568",
      "pmid": null,
      "published_date": "2025 Mar 26"
    },
    "status": "released",
    "submitted_date": "2025-03-26",
    "released_date": "2025-04-11"
  },
  "pddf_data": "https://www.sasbdb.org/media/p_of_R_files/SASDXG2.out",
  "intensities_data": "https://www.sasbdb.org/media/intensities_files/SASDXG2.dat",
  "intensities_log_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDXG2_dat_img.png",
  "intensities_kratky_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDXG2_kratky_img.png",
  "pddf_plot": "https://www.sasbdb.org/media/p_of_R_files/pofr_images/SASDXG2_pofr_img.png",
  "intensities_guinier_plot": "https://www.sasbdb.org/media/intensities_files/scattering_plots/SASDXG2_guinier_img.png",
  "sascif_data": "https://www.sasbdb.org/media/sascif/sascif_files/SASDXG2.sascif",
  "experiment": {
    "instrument": {
      "detector": null,
      "name": "ISIS Neutron and Muon Source",
      "city": "Didcot",
      "country": "UK",
      "beamline_name": "SANS2D",
      "beam_geometry": null,
      "type_of_source": "neutron source",
      "point_source": null,
      "line_collimation": null,
      "sample_path_length": null,
      "line_collimation_slitlength": null,
      "line_collimation_integrationwidth": null,
      "xray_energy": null,
      "beam_profile_ah": null,
      "beam_profile_al": null
    },
    "sample": {
      "molecule": [
        {
          "long_name": "Probable conserved Mce associated membrane protein",
          "short_name": "Mam1A delta 106",
          "sequence": "MKHHHHHHPMSDYDIPTTENLYFQGAMAPDAGAMSASMQKIIECGTGDFGAQASLYTSMLVEAYQAASVHVQVTDMRAAVERNNNDGSVDVLVALRVKVSNTDSDAHEVGYRLRVRMALDEGRYKIAKLDQVTK",
          "organism": "Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)",
          "uniprot_code": "O07419",
          "uniprot_range_first": 107,
          "uniprot_range_last": 213,
          "oligomerization": "tetramer",
          "molecular_type": "protein",
          "uniprot_sequence": "MKAADSAESDAGADQTGPQVKAADSAESDAGELGEDACPEQALVERRPSRLRRGWLVGIA\nATLLALAGGLGAAGYFALRSHQESQSIAREDLAAIEAAKDCVAATQAPDAGAMSASMQKI\nIECGTGDFGAQASLYTSMLVEAYQAASVHVQVTDMRAAVERNNNDGSVDVLVALRVKVSN\nTDSDAHEVGYRLRVRMALDEGRYKIAKLDQVTK",
          "mw": 14.807,
          "total_mw": 59.228,
          "number_molecules": 4,
          "complex_state": false,
          "deuteration": null,
          "molecule_source": "biological",
          "molecule_description": "Mam1A/Rv0175 delta 106 is N-terminally truncated construct which lacks the alpha1-helix. Protein, despite the removal of TM-helix, is not soluble and required C12E9 detergent to be solubilized. Tetrameric form was calculated with SEC-MALS."
        }
      ],
      "buffer": {
        "name": "50 mM Tris, 500 mM NaCl, D-C12E9",
        "concentration_unit": null,
        "comment": "50mM Tris at pH8.5 with 500mM NaCl, supplemented with 0.003% Deuterated C12E9",
        "additive": null,
        "concentration": null,
        "pka": null,
        "ph": 8.5,
        "deuteration": null
      },
      "purity_method": null,
      "name": "Probable conserved Mce associated membrane protein (Mam1Adelta106) from M.tuberculosis (SANS)",
      "ext_coefficient": null,
      "contrast": null,
      "specific_vol": null,
      "dry_vol": null,
      "absorbption": null,
      "deuteration": null,
      "mixture": null
    },
    "contributor": [
      {
        "affiliation": [
          {
            "short_name": null,
            "address": null,
            "full_name": "University of Helsinki",
            "webpage": null
          }
        ],
        "contributor_name": "Mikko",
        "contributor_surname": "Hynönen",
        "orcid": "https://orcid.org/0000-0003-2431-8892"
      },
      {
        "affiliation": [
          {
            "short_name": null,
            "address": "Finland",
            "full_name": "University of Oulu",
            "webpage": "https://www.oulu.fi"
          }
        ],
        "contributor_name": "Rajaram",
        "contributor_surname": "Venkatesan",
        "orcid": "https://orcid.org/0000-0002-7257-1211"
      }
    ],
    "concentration_method": null,
    "concentration_unit": null,
    "date": "2024-04-25",
    "storage_temperature": 4.0,
    "cell_temperature": 6.0,
    "exposure_time": null,
    "number_of_frames": null,
    "wavelength": null,
    "sample_detector_distance": null,
    "concentration_min": null,
    "concentration_max": null,
    "sample_volume": 35.0,
    "flow_rate": 0.07,
    "s_min": 0.062,
    "s_max": 7.827,
    "total_exposure_time": null,
    "seccolumn": null
  },
  "fits": [
    {
      "models": [
        {
          "model_plot": "https://www.sasbdb.org/media/pdb_file/images/1A_107_Main_Model_Tetra_img.png",
          "software": "AlphaFold",
          "pdb_link": [],
          "model_title": "1A_107_Main_Model_Tetra_SASDXG2",
          "type_of_model": "atomic",
          "software_version": null,
          "model_data": "https://www.sasbdb.org/media/pdb_file/1A_107_Main_Model_Tetra.pdb",
          "model_mw": 59.49,
          "bead_radius": 1.9,
          "log": null,
          "symmetry": null,
          "comment": null,
          "user": 1328
        }
      ],
      "fit_unit": "1/A",
      "fit_plot": "https://www.sasbdb.org/media/fitting_files/scattering_plots/SASDXG2_fit1_fixed_fit_img.png",
      "software": "CRYSON",
      "chi_square_value": 2.58,
      "p_value": 0.0272,
      "fit_residual_plot": "SASDXG2_fit1_fitresiduals_img.png",
      "fit_data": "https://www.sasbdb.org/media/fitting_files/SASDXG2_fit1.fit",
      "fit_log": "https://www.sasbdb.org/media/fitting_files/log_files/SASDXG2_1A_107_Main_Model_Cryson_3Bcycig.log",
      "software_version": null,
      "description": ""
    }
  ],
  "estimated_volume_method": null,
  "pddf_software": "ATSAS GNOM",
  "pddf_software_version": "5.0",
  "i0_calibration_standard": null,
  "description": "SANS data were collected on the Zoom time-of-flight SANS instrument (ISIS Neutron and Muon Source, Harwell, UK) using wavelength range 1.75-16.5Å. The source to sample and sample to detector distance was 4 m and the beam size was 12 mm. Mam1Adelta106 was solubilized with C12E9 in the lysis buffer where the deuteration of the C12E9 was 0.2 % v/v. Excess C12E9 was washed away throughout the purification, and replaced with D-C12E9 in the STFC SANS facilities using SEC Superdex200 column.  From the highest point of the peak, 3 fractions were selected. Each of these fractions was loaded to Starna Scientific quartz round cuvette (match code 6,path length 1, type 32/Q/1), and SANS data were collected from each fraction with an exposure time of 1 h in 5 cycles (5 h total exposure time for each fraction). The neutron momentum transfer (q) standard deviation and truncated scattering data are provided as an additional file.",
  "experiment_description": null,
  "tags": [],
  "intensity_unit": "arbitrary",
  "experimental_mw": 33.1,
  "experimental_mw_error": null,
  "guinier_i0_mw": null,
  "guinier_i0_mw_error": null,
  "porod_mw": 20.0,
  "porod_mw_error": null,
  "pddf_i0": 0.126,
  "pddf_i0_error": null,
  "guinier_i0": 0.124085,
  "guinier_i0_error": null,
  "pddf_rg": 2.58,
  "pddf_rg_error": null,
  "guinier_rg": 2.553,
  "guinier_rg_error": 0.683,
  "pddf_dmax": 8.5,
  "pddf_dmax_error": null,
  "porod_volume": 70.0,
  "porod_volume_error": null,
  "estimated_volume": null,
  "estimated_volume_error": null,
  "guinier_point_first": 17,
  "guinier_point_last": 28,
  "pddf_point_first": 18,
  "pddf_point_last": 44,
  "i0_calibration_standard_data": null,
  "intensities_log_log_plot": "SASDXG2_datloglog_img.png",
  "symmetry": null,
  "last_modified": "2026-05-05T11:41:40.417306+02:00",
  "bragg_peak": []
}

{
  "code": "SASDXG2",
  "status": "success",
  "started_at": "2026-08-11T13:38:37.444224+00:00",
  "finished_at": "2026-08-11T13:38:44.321680+00:00",
  "source_last_modified": "2026-05-05T11:41:40.417306+02:00",
  "files": [
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/rest-api/entry/summary/SASDXG2/",
      "path": "/data/saxsdb/sasbdb/entries/g2/sasdxg2/source/summary.json",
      "size": 8395,
      "sha256": "f72f3b03b2aa1bc3db54688448e8cab931e1c3efce5efff3b6f7e80670401dea"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/intensities_files/SASDXG2.dat",
      "path": "/data/saxsdb/sasbdb/entries/g2/sasdxg2/source/SASDXG2.dat",
      "size": 2996,
      "sha256": "52ffdcf092daa30acfe485bb7c914c1a129eb3119052d80d2104b0e66c163565",
      "role": "curve"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/p_of_R_files/SASDXG2.out",
      "path": "/data/saxsdb/sasbdb/entries/g2/sasdxg2/source/SASDXG2.out",
      "size": 6581,
      "sha256": "55df9df9a5be4e51c15c039cbae8e31382c9bdc4f19c29027c4e943872b329d9",
      "role": "pddf"
    },
    {
      "status": "not_available",
      "url": "https://www.sasbdb.org/media/sascif/sascif_files/SASDXG2.sascif",
      "path": "/data/saxsdb/sasbdb/entries/g2/sasdxg2/source/SASDXG2.sascif",
      "role": "sascif"
    },
    {
      "status": "downloaded",
      "url": "https://www.sasbdb.org/media/zip_directories/SASDXG2.zip",
      "path": "/data/saxsdb/sasbdb/entries/g2/sasdxg2/source/SASDXG2.zip",
      "size": 91770,
      "sha256": "8f2e332ffb5a5ee64b3a9e96751f25d09bf776aec2e0f07aba6582de4f173122",
      "role": "full_entry_zip",
      "zip_member_count": 8,
      "zip_validation": "central_directory_readable"
    }
  ]
}