← Back to search

10zo

Crystal structure of Mengla virus nucleoprotein bound by a cross-reactive anti-Marburg virus nanobody

Method: X-RAY DIFFRACTION D_max: 80.0 Å Quality: EXCELLENT

SAXS Profile

P(r) Distribution

▼

1. Structure Basics

entry_id	10zo
deposition_date	2026-02-12
last_revision	2026-03-25
title	Crystal structure of Mengla virus nucleoprotein bound by a cross-reactive anti-Marburg virus nanobody
keywords	Filovirus, Mengla, Marburg, nucleoprotein, nanobody, IMMUNE SYSTEM, IMMUNE SYSTEM-VIRAL PROTEIN complex; IMMUNE SYSTEM/VIRAL PROTEIN
method	X-RAY DIFFRACTION

▼

Download Data

SAXS curve (.dat) P(r) distribution (.pr.out) Structure (CIF)

▼

2. SAXS Parameters (CRYSOL)

rg_guinier	25.18 Å
rg_electron	24.31 Å
i0	27849100.00
molecular_weight	40289.0 kDa
excluded_volume	50254 Å³
envelope_volume	62852 Å³
shell_volume	22123 Å³
envelope_diameter	81.9 Å
shell_rg	30.48 Å
envelope_rg	24.10 Å
shape_rg	24.28 Å
total_rg	25.14 Å
total_atoms	2841
n_residues	351
n_harmonics	20
q_range	— – 0.5000 Å⁻¹
n_points	101
shell_type	directional
solvent_density	0.3340 e/Å³
contrast_shell	0.0300 e/Å³
crysol_version	4.1.3

▼

3. P(r) Analysis (GNOM)

dmax	80.0 Å
rg_real	25.15 Å
rg_real_error	0.47 Å
i0_real	2.7850e+07
i0_real_error	4.0260e+05
rg_reciprocal	25.16 Å
i0_reciprocal	27850000.0000
total_estimate	0.9041
solution_quality	EXCELLENT a EXCELLENT solution
n_peaks	3
r_peak_primary	24.1 Å
skewness	0.201
kurtosis	-0.638
angular_range	— – 0.3150 Å⁻¹
current_alpha	0.0000
highest_alpha	7672000.0000
n_real_points	64
gnom_version	4.1.3
quality_criteria	AN1: 0.000; Oscil: 0.935; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.951; Smooth: 0.992

▶

4. Crystallography & Experiment

▶

5. Entities & Polymer Info (3)

Entity 1 polymer

description	Anti-Marburgvirus Nucleoprotein Single Domain Antibody A
formula_weight	13272.9 kDa
src_method	man
entity_count	2

Polymer

type	polypeptide(L)
strand_id	A,C
atom_count	3289

EVKLQESGGGLVQAGESLRLSCAVPPEVFDIRTVAWYRQVPLGKGRELLSSITPWNKTTYEDSVKDRFTISRDNAKYTVYLQMNDLKPEDTAVYYCAQGWGIASMRYWGQGTQVTVSS

Source

organism	Lama glama
ncbi_taxonomy_id	9844
host_organism	Escherichia coli

Entity 2 polymer

description	Nucleoprotein
formula_weight	11969.1 kDa
src_method	man
entity_count	2

Polymer

type	polypeptide(L)
strand_id	B,D

KIHHHHHHGGGSVPSAPPSSPTPSTNRQGEAQTQNGEDSSQDWPRRVKTNKGREFMFPTDLLHRTPPQVLLDALVNEYESPLSATELSDDWPEMTFEERKNVAFNL

Source

organism	Dianlovirus menglaense
ncbi_taxonomy_id	3052181
host_organism	Escherichia coli

Entity 3 water

description	water
formula_weight	18.0 kDa
src_method	nat
entity_count	364

▶

6. Citations (1)

▶

length_a	214.284 Å
length_b	214.284 Å
length_c	57.338 Å
angle_alpha	90.00 °
angle_beta	90.00 °
angle_gamma	120.00 °
z_pdb	36

space_group	H 3 2
int_tables_number	155
crystal_system	trigonal

resolution	1.650 Å
resolution_low	24.060 Å
r_factor	0.1651
r_work	0.1634
r_free	0.2143

fit	/app/data/saxs_computation/0z/10zo/10zo.fit
pddf	/app/data/pr_computation/0z/10zo/10zo.pr.out
profile	/app/data/saxs_computation/0z/10zo/10zo.dat

Crystal structure of Mengla virus nucleoprotein bound by a cross-reactive anti-Marburg virus nanobody

SAXS Profile

P(r) Distribution

1. Structure Basics

Download Data

2. SAXS Parameters (CRYSOL)

3. P(r) Analysis (GNOM)

4. Crystallography & Experiment

Unit Cell

Symmetry

Refinement

Diffraction

5. Entities & Polymer Info (3)

Entity 1 polymer

Polymer

Source

Entity 2 polymer

Polymer

Source

Entity 3 water

6. Citations (1)

7. Files & Curves (10)

Files (7)

Curves (3)