SAXSdb — 12is

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

SnoaL-like domain-containing protein

Mycobacterium ulcerans Agy99

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 2	DI(HYDROXYETHYL)ETHER × 2 ZINC ION × 2 CHLORIDE ION × 2 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0PR67_MYCUA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 24–146； UniProt 2–124

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	12is
Deposition date deposition_date	2026-04-07
Last revision last_revision	2026-04-15
Structure title title	Crystal structure of a SnoaL-like domain-containing protein from Mycobacterium ulcerans (Zinc Bound)
Keywords keywords	;SSGCID, STRUCTURAL GENOMICS, SEATTLE STRUCTURAL GENOMICS CENTER FOR INFECTIOUS DISEASE, SnoaL-like domain, Mycobacterium ulcerans, ISOMERASE ;; ISOMERASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

12is__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

12is__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

12is__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	19.69 Å
Rg (electron density)	18.53 Å
Total Rg	19.53 Å
Atom count	1994
Residues	238
Excluded volume	35435 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`12is__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	SnoaL-like domain-containing protein
Molecular weight formula_weight	16936.1 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	1217

MAHHHHHHMGTLEAQTQGPGSMVSIALLREMFEKMVVAKNAELIGHYYDPDFVMYSDGLRQEFAEFNEGHRKIYASAISYAIEYDEDAWVQAPDRVAGRVWITTSRPGEKPTRIEVILIAAYRDCRIHRIWETTWPSWRNVAALED

Source Source

Source organism organism	Mycobacterium ulcerans Agy99
NCBI taxonomy ID ncbi_taxonomy_id	362242
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 non-polymer

Description description	DI(HYDROXYETHYL)ETHER
Molecular weight formula_weight	106.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 3 Entity 3 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 4 Entity 4 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	116

▶

Unit-cell length a length_a	62.071 Å
Unit-cell length b length_b	71.662 Å
Unit-cell length c length_c	56.341 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	C 2 2 21
Space-group number int_tables_number	20
Crystal system crystal_system	—

Resolution resolution	1.310 Å
Low-resolution limit resolution_low	36.050 Å
R factor r_factor	0.1503
R_work r_work	0.1491
R_free r_free	0.1742

Crystal structure of a SnoaL-like domain-containing protein from Mycobacterium ulcerans (Zinc Bound)

1. Protein Identity and Related Structures Protein Identity & Related Structures

SnoaL-like domain-containing protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

12is__assembly_1__model_1

12is__assembly_1__model_1 | I(q)

12is__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Citations (1)

Crystal structure of a SnoaL-like domain-containing protein from Mycobacterium ulcerans (Zinc Bound)

1. Protein Identity and Related Structures Protein Identity & Related Structures

SnoaL-like domain-containing protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

12is__assembly_1__model_1

12is__assembly_1__model_1 | I(q)

12is__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Citations (1)