SAXSdb — 1cwp

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Coat protein

OrganismNot specified

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–RNA Homooligomer Protein × 180 RNA 180 PDB declaration: 360-MERIC（360） Consistent with all polymer counts	Chain A； UniProt 1–189 Chain B； UniProt 1–189 Chain C； UniProt 1–189	Not recorded	;RNA (5'-R(APUPAPU)-3') ; × 120 ;RNA (5'-R(APU)-3') ; × 60	X-RAY DIFFRACTION mmCIF provides none of the parsed experimental conditions	Resolution 3.20 Å
2	Protein–RNA Homooligomer Protein × 3 RNA 3 PDB declaration: hexameric（6） Consistent with all polymer counts	Chain A； UniProt 1–189 Chain B； UniProt 1–189 Chain C； UniProt 1–189	Not recorded	;RNA (5'-R(APUPAPU)-3') ; × 2 ;RNA (5'-R(APU)-3') ; × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed experimental conditions	Resolution 3.20 Å
3	Protein–RNA Homooligomer Protein × 15 RNA 15 PDB declaration: 30-meric（30） Consistent with all polymer counts	Chain A； UniProt 1–189 Chain B； UniProt 1–189 Chain C； UniProt 1–189	Not recorded	;RNA (5'-R(APUPAPU)-3') ; × 10 ;RNA (5'-R(APU)-3') ; × 5	X-RAY DIFFRACTION mmCIF provides none of the parsed experimental conditions	Resolution 3.20 Å
4	Protein–RNA Homooligomer Protein × 18 RNA 18 PDB declaration: 36-meric（36） Consistent with all polymer counts	Chain A； UniProt 1–189 Chain B； UniProt 1–189 Chain C； UniProt 1–189	Not recorded	;RNA (5'-R(APUPAPU)-3') ; × 12 ;RNA (5'-R(APU)-3') ; × 6	X-RAY DIFFRACTION mmCIF provides none of the parsed experimental conditions	Resolution 3.20 Å
5	Protein–RNA Homooligomer Protein × 3 RNA 3 PDB declaration: hexameric（6） Consistent with all polymer counts	Chain A； UniProt 1–189 Chain B； UniProt 1–189 Chain C； UniProt 1–189	Not recorded	;RNA (5'-R(APUPAPU)-3') ; × 2 ;RNA (5'-R(APU)-3') ; × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed experimental conditions	Resolution 3.20 Å
6	Protein–RNA Homooligomer Protein × 180 RNA 180 PDB declaration: 360-meric（360） Consistent with all polymer counts	Chain A； UniProt 1–189 Chain B； UniProt 1–189 Chain C； UniProt 1–189	Not recorded	;RNA (5'-R(APUPAPU)-3') ; × 120 ;RNA (5'-R(APU)-3') ; × 60	X-RAY DIFFRACTION mmCIF provides none of the parsed experimental conditions	Resolution 3.20 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 1CWP	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1ZA7 The crystal structure of salt stable cowpea cholorotic mottle virus at 2.7 angstroms resolution. Deposited 2005-04-05	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 180 PDB declaration: 180-MERIC	Chain A 25–189（165 aa） Chain B 25–189（165 aa） Chain C 25–189（165 aa）	Mutation：K42R Mutation：K42R Mutation：K42R	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 3.3；298 K；0.3M succinate, 4% PEG 8000, pH 3.3, VAPOR DIFFUSION, SITTING DROP, temperature 298K, pH 3.30	Resolution 2.70 Å
1ZA7 The crystal structure of salt stable cowpea cholorotic mottle virus at 2.7 angstroms resolution. Deposited 2005-04-05	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 25–189（165 aa） Chain B 25–189（165 aa） Chain C 25–189（165 aa）	Mutation：K42R Mutation：K42R Mutation：K42R	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 3.3；298 K；0.3M succinate, 4% PEG 8000, pH 3.3, VAPOR DIFFUSION, SITTING DROP, temperature 298K, pH 3.30	Resolution 2.70 Å
1ZA7 The crystal structure of salt stable cowpea cholorotic mottle virus at 2.7 angstroms resolution. Deposited 2005-04-05	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 15 PDB declaration: pentadecameric	Chain A 25–189（165 aa） Chain B 25–189（165 aa） Chain C 25–189（165 aa）	Mutation：K42R Mutation：K42R Mutation：K42R	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 3.3；298 K；0.3M succinate, 4% PEG 8000, pH 3.3, VAPOR DIFFUSION, SITTING DROP, temperature 298K, pH 3.30	Resolution 2.70 Å
1ZA7 The crystal structure of salt stable cowpea cholorotic mottle virus at 2.7 angstroms resolution. Deposited 2005-04-05	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 18 PDB declaration: octadecameric	Chain A 25–189（165 aa） Chain B 25–189（165 aa） Chain C 25–189（165 aa）	Mutation：K42R Mutation：K42R Mutation：K42R	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 3.3；298 K；0.3M succinate, 4% PEG 8000, pH 3.3, VAPOR DIFFUSION, SITTING DROP, temperature 298K, pH 3.30	Resolution 2.70 Å
1ZA7 The crystal structure of salt stable cowpea cholorotic mottle virus at 2.7 angstroms resolution. Deposited 2005-04-05	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 25–189（165 aa） Chain B 25–189（165 aa） Chain C 25–189（165 aa）	Mutation：K42R Mutation：K42R Mutation：K42R	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 3.3；298 K；0.3M succinate, 4% PEG 8000, pH 3.3, VAPOR DIFFUSION, SITTING DROP, temperature 298K, pH 3.30	Resolution 2.70 Å
1ZA7 The crystal structure of salt stable cowpea cholorotic mottle virus at 2.7 angstroms resolution. Deposited 2005-04-05	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 6 Protein homooligomer Homooligomer；Protein × 180 PDB declaration: 180-meric	Chain A 25–189（165 aa） Chain B 25–189（165 aa） Chain C 25–189（165 aa）	Mutation：K42R Mutation：K42R Mutation：K42R	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 3.3；298 K；0.3M succinate, 4% PEG 8000, pH 3.3, VAPOR DIFFUSION, SITTING DROP, temperature 298K, pH 3.30	Resolution 2.70 Å
8C38 Contracted cowpea chlorotic mottle virus Deposited 2022-12-23	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 180 PDB declaration: 180-meric	Chain C 1–190（190 aa） Chain D 1–190（190 aa） Chain I 1–190（190 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 1.64 Å
8CPY Extended cowpea chlorotic mottle virus Deposited 2023-03-03	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 180 PDB declaration: 180-meric	Chain C 1–190（190 aa） Chain D 1–190（190 aa） Chain I 1–190（190 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 4.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å

3 other PDB entries and 8 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	COAT_CCMV
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain A； PDBConstruct 1–190； UniProt 1–189 Author chain B； PDBConstruct 1–190； UniProt 1–189 Author chain C； PDBConstruct 1–190； UniProt 1–189

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1cwp
Deposition date deposition_date	1995-05-22
Structure title title	STRUCTURES OF THE NATIVE AND SWOLLEN FORMS OF COWPEA CHLOROTIC MOTTLE VIRUS DETERMINED BY X-RAY CRYSTALLOGRAPHY AND CRYO-ELECTRON MICROSCOPY
Keywords keywords	BROMOVIRUS, Icosahedral virus, Virus-RNA COMPLEX; Virus/RNA
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	28.19 Å
Radius of gyration Rg (electron density) rg_electron	27.81 Å
Forward intensity I(0) i0	49107200.00
Molecular weight molecular_weight	53907.0 kDa
Excluded volume excluded_volume	67352 Å³
Envelope volume envelope_volume	99203 Å³
Hydration-shell volume shell_volume	29800 Å³
Envelope diameter envelope_diameter	101.7 Å
Shell Rg shell_rg	34.57 Å
Envelope Rg envelope_rg	29.12 Å
Shape Rg shape_rg	27.77 Å
Total Rg total_rg	28.70 Å
Total atoms total_atoms	3784
Residues n_residues	487
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	97.2 Å
Rg (real space) rg_real	28.17 Å
Rg uncertainty (real space) rg_real_error	0.75 Å
I(0) (real space) i0_real	4.9110e+07
I(0) uncertainty (real space) i0_real_error	7.7300e+05
Rg (reciprocal space) rg_reciprocal	28.18 Å
I(0) (reciprocal space) i0_reciprocal	49110000.0000
Solution quality estimate total_estimate	0.8789
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	31.2 Å
Skewness Skewness skewness	0.299
Kurtosis Kurtosis kurtosis	-0.329
Angular range angular_range	— – 0.2800 Å⁻¹
Current regularization parameter α current_alpha	0.0001
Highest regularization parameter α highest_alpha	9161000.0000
Real-space data points n_real_points	57
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.829; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.958; Smooth: 0.978

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	;RNA (5'-R(APUPAPU)-3') ;
Molecular weight formula_weight	1225.8 kDa
Source method src_method	syn
Copy count entity_count	2

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	D,F
Atom count atom_count	3784

AUAU

Entity 2 Entity 2 polymer

Description description	;RNA (5'-R(APU)-3') ;
Molecular weight formula_weight	590.4 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	E

AU

Entity 3 Entity 3 polymer

Description description	Coat protein
Molecular weight formula_weight	20336.3 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C

MSTVGTGKLTRAQRRAAARKNKRNTRVVQPVIVEPIASGQGKAIKAWTGYSVSKWTASCAAAEAKVTSAITISLPNELSSERNKQLKVGRVLLWLGLLPSVSGTVKSCVTETQTTAAASFQVALAVADNSKDVVAAMYPEAFKGITLEQLAADLTIYLYSSAALTEGDVIVHLEVEHVRPTFDDSFTPVY

▼

7. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (3 domains)

Domain ID domain_id	d1cwpa_
Class class	b — All beta proteins
Fold Fold fold	b.121 — Nucleoplasmin-like/VP (viral coat and capsid proteins)
Superfamily Superfamily superfamily	b.121.4 — Positive stranded ssRNA viruses
Family Family family	b.121.4.5 — Bromoviridae-like VP

Domain ID domain_id	d1cwpb_
Class class	b — All beta proteins
Fold Fold fold	b.121 — Nucleoplasmin-like/VP (viral coat and capsid proteins)
Superfamily Superfamily superfamily	b.121.4 — Positive stranded ssRNA viruses
Family Family family	b.121.4.5 — Bromoviridae-like VP

Domain ID domain_id	d1cwpc_
Class class	b — All beta proteins
Fold Fold fold	b.121 — Nucleoplasmin-like/VP (viral coat and capsid proteins)
Superfamily Superfamily superfamily	b.121.4 — Positive stranded ssRNA viruses
Family Family family	b.121.4.5 — Bromoviridae-like VP

CATH v4.4 (3 domains)

Domain ID domain_id	1cwpA00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	220 — Satellite virus coat domain

Domain ID domain_id	1cwpB01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	220 — Satellite virus coat domain

Domain ID domain_id	1cwpC01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	220 — Satellite virus coat domain

▶

8. Citations (4)

▶

Unit-cell length a length_a	381.300 Å
Unit-cell length b length_b	381.300 Å
Unit-cell length c length_c	408.600 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	720

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	3.200 Å
Low-resolution limit resolution_low	7.000 Å
R factor r_factor	0.3100
R_work r_work	0.3100
R_free r_free	—

fit	/app/data/saxs_computation/cw/1cwp/1cwp.fit
pddf	/app/data/pr_computation/cw/1cwp/1cwp.pr.out
profile	/app/data/saxs_computation/cw/1cwp/1cwp.dat

STRUCTURES OF THE NATIVE AND SWOLLEN FORMS OF COWPEA CHLOROTIC MOTTLE VIRUS DETERMINED BY X-RAY CRYSTALLOGRAPHY AND CRYO-ELECTRON MICROSCOPY

1. Protein Identity and Related Structures Protein Identity & Related Structures

Coat protein

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

7. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (3 domains)

CATH v4.4 (3 domains)

8. Citations (4)

9. Files and Curves (10)

Files (7)

Curves (3)