SAXSdb — 1e42

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

AP-2 COMPLEX SUBUNIT BETA

HOMO SAPIENS

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein monomer Monomer Protein × 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain A； UniProt 701–937	Fragment：APPENDAGE DOMAIN, RESIDUES 701-937	DTD DITHIANE DIOL × 1 MG MAGNESIUM ION × 1 CL CHLORIDE ION × 2 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions：pH 8.8；WELL SOLUTION: 1.6 - 2.0M MGCL2, 0.1M BICINE PH 8.7 - 9.0, 15% GLYCEROL, 1MM DTT. PROTEIN: 40MG/ML, 5MM HEPES, 50MM NACL, 4MM DTT, 1:1 MIXTURE	Resolution 1.70 Å R-free 0.246
2	Protein monomer Monomer Protein × 1 PDB declaration: monomeric（1） Consistent with protein copy count	Chain B； UniProt 701–937	Fragment：APPENDAGE DOMAIN, RESIDUES 701-937	DTD DITHIANE DIOL × 1 MG MAGNESIUM ION × 3 CL CHLORIDE ION × 2 GOL GLYCEROL × 1 NI NICKEL (II) ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：pH 8.8；WELL SOLUTION: 1.6 - 2.0M MGCL2, 0.1M BICINE PH 8.7 - 9.0, 15% GLYCEROL, 1MM DTT. PROTEIN: 40MG/ML, 5MM HEPES, 50MM NACL, 4MM DTT, 1:1 MIXTURE	Resolution 1.70 Å R-free 0.246

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 1E42	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2G30 beta appendage of AP2 complexed with ARH peptide Deposited 2006-02-17	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 701–937（237 aa） Fragment：residues 701-937	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；289 K；18% PEG 8000, 100mM HEPES pH 7.5, 4mM DTT, VAPOR DIFFUSION, SITTING DROP, temperature 289K	Resolution 1.60 Å R-free 0.243
2IV8 beta appendage in complex with b-arrestin peptide Deposited 2006-06-08	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 700–937（238 aa） Fragment：RESIDUES 700-937	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.4；0.2M MG FORMATE 30% PEG 3350 OTHER REMARKS: THIS WAS THE ONLY CRYSTAL OBTAINED DESPITE HEROIC ATTEMPTS. THE CRYSTAL WAS HIGHLY MOSAIC, AND EPITAXIALLY SPLIT, LIMITING THE AMOUNT OF DATA WHICH COULD BE COLLECTED., pH 7.40	Resolution 2.80 Å R-free 0.369
2IV9 B2-appendage from AP2 in complex with Eps15 peptide Deposited 2006-06-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 700–937（238 aa） Fragment：APPENDAGE DOMAIN, RESIDUES 700-937 Chain B 700–937（238 aa） Fragment：APPENDAGE DOMAIN, RESIDUES 700-937	Not recorded	SO4 SULFATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions pH 4.5；2M AMMONIUM SULPHATE, 0.1M AMMONIUM ACETATE PH 4.5	Resolution 1.90 Å R-free 0.267
2JKR AP2 CLATHRIN ADAPTOR CORE with Dileucine peptide RM(phosphoS)QIKRLLSE Deposited 2008-08-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain B 1–591（591 aa） Fragment：BETA2 CHAIN, RESIDUES 1-591	Not recorded	SO4 SULFATE ION × 14	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.5；1.7-2.2M AMMONIUM SULPHATE, 100MM SODIUM CITRATE PH6 .5 AND 5MM DTT FROM A MIXTURE OF 10MG/ML AP2 CORE AND 7MG/ML PEPTIDE. CRYOPROTECTED WITH 1.8-2.3M AMMONIUM SULPHATE, 100MM SODIUM CITRATE PH 6.5, 17% GLYCEROL AND 7MG/ ML CD4 DILEUCINE PEPTIDE	Resolution 2.98 Å R-free 0.260
2JKR AP2 CLATHRIN ADAPTOR CORE with Dileucine peptide RM(phosphoS)QIKRLLSE Deposited 2008-08-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 1–591（591 aa） Fragment：BETA2 CHAIN, RESIDUES 1-591	Not recorded	SO4 SULFATE ION × 17	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.5；1.7-2.2M AMMONIUM SULPHATE, 100MM SODIUM CITRATE PH6 .5 AND 5MM DTT FROM A MIXTURE OF 10MG/ML AP2 CORE AND 7MG/ML PEPTIDE. CRYOPROTECTED WITH 1.8-2.3M AMMONIUM SULPHATE, 100MM SODIUM CITRATE PH 6.5, 17% GLYCEROL AND 7MG/ ML CD4 DILEUCINE PEPTIDE	Resolution 2.98 Å R-free 0.260
2JKT AP2 CLATHRIN ADAPTOR CORE with CD4 Dileucine peptide RM(phosphoS) EIKRLLSE Q to E mutant Deposited 2008-08-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain B 1–591（591 aa） Fragment：BETA2 CHAIN, RESIDUES 1-591	Not recorded	SO4 SULFATE ION × 15	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.5；1.7-2.2M AMMONIUM SULPHATE, 100MM SODIUM CITRATE PH6 .5 AND 5MM DTT FROM A MIXTURE OF 10MG/ML AP2 CORE AND 7MG/ML PEPTIDE. CRYOPROTECTED WITH 1.8-2.3M AMMONIUM SULPHATE, 100MM SODIUM CITRATE PH 6.5, 17% GLYCEROL AND 7MG/ ML CD4 DILEUCINE PEPTIDE	Resolution 3.40 Å R-free 0.256
2JKT AP2 CLATHRIN ADAPTOR CORE with CD4 Dileucine peptide RM(phosphoS) EIKRLLSE Q to E mutant Deposited 2008-08-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 1–591（591 aa） Fragment：BETA2 CHAIN, RESIDUES 1-591	Not recorded	SO4 SULFATE ION × 16	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.5；1.7-2.2M AMMONIUM SULPHATE, 100MM SODIUM CITRATE PH6 .5 AND 5MM DTT FROM A MIXTURE OF 10MG/ML AP2 CORE AND 7MG/ML PEPTIDE. CRYOPROTECTED WITH 1.8-2.3M AMMONIUM SULPHATE, 100MM SODIUM CITRATE PH 6.5, 17% GLYCEROL AND 7MG/ ML CD4 DILEUCINE PEPTIDE	Resolution 3.40 Å R-free 0.256
2VGL AP2 CLATHRIN ADAPTOR CORE Deposited 2007-11-14	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–591（591 aa） Fragment：1-591	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.2；18% PEG, 10MM NA/K PHOSPHATE PH 6.2, 200MM NACL, 4MM DTT, IP6	Resolution 2.60 Å R-free 0.339
2XA7 AP2 clathrin adaptor core in active complex with cargo peptides Deposited 2010-03-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain B 1–592（592 aa） Fragment：BETA CHAIN, RESIDUES 1-592	Not recorded	SO4 SULFATE ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.5；0.6-0.8M LISO4, 0.6-0.7M NH4SO4, 100MM NA CITRATE PH 6.5; CRYOPROTECTANT 20% GLYCEROL	Resolution 3.10 Å R-free 0.285
2XA7 AP2 clathrin adaptor core in active complex with cargo peptides Deposited 2010-03-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–592（592 aa） Fragment：BETA CHAIN, RESIDUES 1-592	Not recorded	SO4 SULFATE ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.5；0.6-0.8M LISO4, 0.6-0.7M NH4SO4, 100MM NA CITRATE PH 6.5; CRYOPROTECTANT 20% GLYCEROL	Resolution 3.10 Å R-free 0.285
4UQI AP2 controls clathrin polymerization with a membrane-activated switch Deposited 2014-06-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–651（651 aa） Fragment：BETA 2 SUBUNIT EXTENDED TRUNK DOMAIN, RESIDUES 1-651	Not recorded	CL CHLORIDE ION × 1 IHP INOSITOL HEXAKISPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.2；18% PEG1000, 10MM NA/K PHOSPHATE PH 6.2, 200MM NACL, 4MM DTT, IP6	Resolution 2.79 Å R-free 0.259
5M5R Clathrin heavy chain N-terminal domain bound to beta2 adaptin clathrin box motif Deposited 2016-10-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 629–637（9 aa） Fragment：UNP Residues 629-637 Chain D 629–637（9 aa） Fragment：UNP Residues 629-637	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.7；293 K；1 uL protein plus peptide mix (14 mg/mL NTD and 3.4 mM peptide) plus 2 uL reservoir equilibrated against a 200 uL reservoir of 0.94 M sodium malonate pH 6.7	Resolution 1.76 Å R-free 0.205
6QH5 AP2 clathrin adaptor mu2T156-phosphorylated core in closed conformation Deposited 2019-01-15	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain B 1–592（592 aa）	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.2；289 K；20% PEG 1000; 100 mM Na+/K+ phosphate buffer (pH 7.2), 200 mM NaCl, and 10 mM DTT	Resolution 2.56 Å R-free 0.257
6QH6 AP2 clathrin adaptor core with two cargo peptides in open+ conformation Deposited 2019-01-15	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain B 1–592（592 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.4；289 K；7.5% PVA, 9% 1-propanol, 90 mM Hepes pH 7.4, 100 mM guanidine hydrochloride	Resolution 5.00 Å R-free 0.285
6QH7 AP2 clathrin adaptor mu2T156-phosphorylated core with two cargo peptides in open+ conformation Deposited 2019-01-15	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain B 1–592（592 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.4；289 K；7.5% PVA, 9% 1-propanol, 90 mM Hepes pH 7.4, 100 mM guanidine hydrochloride	Resolution 3.40 Å R-free 0.248
6URI HIV-1 Nef in complex with the CD4 cytoplasmic domain and the AP2 clathrin adaptor complex Deposited 2019-10-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain B 1–591（591 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions MICROBATCH；pH 6.9；298 K；15% Peg 4000, 0.2M potassium chloride, ~10% 1,6-hexanediol, 0.1M HEPES	Resolution 3.00 Å R-free 0.277
6YAE AP2 core in physiological buffer Deposited 2020-03-12	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–591（591 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.90 Å
6YAF AP2 on a membrane containing tyrosine-based cargo peptide Deposited 2020-03-12	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain B 1–937（937 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；The sample was supplemented with 10 nm nanogold fiducials, and 3 ul of the mixture was backside blotted for 3 seconds.	Resolution 9.10 Å
6YAH AP2 in clathrin coats assembled on a membrane containing dileucine- and tyrosine-based cargo peptides Deposited 2020-03-12	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–937（937 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；The sample was supplemented with 10 nm nanogold fiducials, and 3 ul of the mixture was backside blotted for 3 seconds.	Resolution 10.20 Å
6YAI Clathrin with bound beta2 appendage of AP2 Deposited 2020-03-12	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 14 PDB declaration: tetradecameric	Chain F 719–951（233 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.2 cryo-EM vitrification conditions Cryogen ETHANE；The sample was supplemented with 10 nm nanogold fiducials, and 3 ul of the mixture was backside blotted for 3 seconds.	Resolution 9.20 Å
7OG1 AP2 clathrin adaptor core in complex with cargo peptide and FCHO2 Deposited 2021-05-05	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain BBB 1–591（591 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；289 K；Crystals of AP-2 in complex with FCHO2 linker and TGN38 peptide, supplemented with 10mM K Na Tartrate, grew in sitting drops with reservoir 0.1M Mg formate dehydrate, 10% to 15% PEG 3350. The crystals were cryo-protected with 0.1M Mg formate dehydrate, 13% PEG 3350, 18-24% Glycerol and 1mg/ml of peptide.	Resolution 3.25 Å R-free 0.306
7OHO Crystal structure of AP2 FCHO2 chimera Deposited 2021-05-11	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain BBB 1–542（542 aa）	Not recorded	IHP INOSITOL HEXAKISPHOSPHATE × 1 GOL GLYCEROL × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.2；289 K；18% PEG 12000 0.1M Na/K phosphate pH 6.2 0.2M NaCl 4mM DTT in the presence of 3-fold molar excess of IP6.	Resolution 2.88 Å R-free 0.273
7OM8 Beta2 appendage domain of AP2 bound to terminal domains beneath the hub of the 28 triskelia mini clathrin coat complex, class 15 Deposited 2021-05-21	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain B 719–951（233 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 6.4 cryo-EM vitrification conditions Cryogen ETHANE-PROPANE；3 uL of sample applied to a grid and blotted for 4.5 s before plunging	Resolution 10.50 Å
7Z5C Chimera of AP2 with FCHO2 linker domain as a fusion on Cmu2 subunit Deposited 2022-03-09	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 1–591（591 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.6；50% HKT buffer (10mM Hepes, 10mM Tris 120mM potassium acetate pH 7.2) and 50% Core buffer (10mM Tris, 250mM NaCl, pH 8) cryo-EM vitrification conditions Cryogen ETHANE	Resolution 4.16 Å

21 other PDB entries and 24 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	AP2B1_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 22–258； UniProt 701–937 Author chain B； PDBConstruct 22–258； UniProt 701–937

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1e42
Deposition date deposition_date	2000-06-27
Structure title title	Beta2-adaptin appendage domain, from clathrin adaptor AP2
Keywords keywords	ENDOCYTOSIS, ADAPTOR; ENDOCYTOSIS
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	29.50 Å
Radius of gyration Rg (electron density) rg_electron	28.88 Å
Forward intensity I(0) i0	43898600.00
Molecular weight molecular_weight	53301.0 kDa
Excluded volume excluded_volume	67323 Å³
Envelope volume envelope_volume	82555 Å³
Hydration-shell volume shell_volume	25628 Å³
Envelope diameter envelope_diameter	110.6 Å
Shell Rg shell_rg	33.44 Å
Envelope Rg envelope_rg	28.82 Å
Shape Rg shape_rg	28.87 Å
Total Rg total_rg	29.37 Å
Total atoms total_atoms	3733
Residues n_residues	466
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	102.5 Å
Rg (real space) rg_real	29.73 Å
Rg uncertainty (real space) rg_real_error	0.80 Å
I(0) (real space) i0_real	4.3900e+07
I(0) uncertainty (real space) i0_real_error	6.0610e+05
Rg (reciprocal space) rg_reciprocal	29.64 Å
I(0) (reciprocal space) i0_reciprocal	43900000.0000
Solution quality estimate total_estimate	0.6401
Solution quality rating solution_quality	REASONABLE a REASONABLE solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	28.5 Å
Skewness Skewness skewness	0.543
Kurtosis Kurtosis kurtosis	-0.163
Angular range angular_range	— – 0.2700 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	8501000.0000
Real-space data points n_real_points	55
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.776; Stabil: 1.000; Sysdev: 0.092; Positv: 1.000; Valcen: 0.817; Smooth: 0.896

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Description description	AP-2 COMPLEX SUBUNIT BETA
Molecular weight formula_weight	29088.5 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	4555

MGSSHHHHHHSSGLVPRGSHMGMAPGGYVAPKAVWLPAVKAKGLEISGTFTHRQGHIYMEMNFTNKALQHMTDFAIQFNKNSFGVIPSTPLAIHTPLMPNQSIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFSCLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTIAKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSILKN

来源 Source

来源生物 organism	HOMO SAPIENS
通用名 common_name	HUMAN
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	ESCHERICHIA COLI

Entity 2 Entity 2 non-polymer

Description description	DITHIANE DIOL
Molecular weight formula_weight	152.2 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 3 Entity 3 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 4 Entity 4 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 5 Entity 5 non-polymer

Description description	GLYCEROL
Molecular weight formula_weight	92.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 6 Entity 6 non-polymer

Description description	NICKEL (II) ION
Molecular weight formula_weight	58.7 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 7 Entity 7 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	822

▼

7. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d1e42a1
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.10 — Clathrin adaptor appendage domain
Family Family family	b.1.10.1 — Alpha-adaptin ear subdomain-like

Domain ID domain_id	d1e42a2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.105 — Subdomain of clathrin and coatomer appendage domain
Superfamily Superfamily superfamily	d.105.1 — Subdomain of clathrin and coatomer appendage domain
Family Family family	d.105.1.1 — Clathrin adaptor appendage, alpha and beta chain-specific domain

Domain ID domain_id	d1e42b1
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.10 — Clathrin adaptor appendage domain
Family Family family	b.1.10.1 — Alpha-adaptin ear subdomain-like

Domain ID domain_id	d1e42b2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.105 — Subdomain of clathrin and coatomer appendage domain
Superfamily Superfamily superfamily	d.105.1 — Subdomain of clathrin and coatomer appendage domain
Family Family family	d.105.1.1 — Clathrin adaptor appendage, alpha and beta chain-specific domain

CATH v4.4 (4 domains)

Domain ID domain_id	1e42A01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	1150 —

Domain ID domain_id	1e42A02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	310 — TATA-Binding Protein
Homologous superfamily homologous superfamily	10 — TATA-Binding Protein

Domain ID domain_id	1e42B01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	1150 —

Domain ID domain_id	1e42B02
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	310 — TATA-Binding Protein
Homologous superfamily homologous superfamily	10 — TATA-Binding Protein

▶

8. Citations (1)

▶

Unit-cell length a length_a	97.040 Å
Unit-cell length b length_b	124.590 Å
Unit-cell length c length_c	67.640 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	124.18 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	C 1 2 1
Space-group number int_tables_number	5
Crystal system crystal_system	—

Resolution resolution	1.700 Å
Low-resolution limit resolution_low	67.420 Å
R factor r_factor	—
R_work r_work	0.1960
R_free r_free	0.2460

fit	/app/data/saxs_computation/e4/1e42/1e42.fit
pddf	/app/data/pr_computation/e4/1e42/1e42.pr.out
profile	/app/data/saxs_computation/e4/1e42/1e42.dat

Beta2-adaptin appendage domain, from clathrin adaptor AP2