1ej6

Reovirus core

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

LAMBDA2

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 300	LAMBDA1 × 120 （P15024） SIGMA2 × 120 （P03525） ZINC ION × 60	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 5	LAMBDA1 × 2 （P15024） SIGMA2 × 2 （P03525） ZINC ION × 1	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 25	LAMBDA1 × 10 （P15024） SIGMA2 × 10 （P03525） ZINC ION × 5	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 30	LAMBDA1 × 12 （P15024） SIGMA2 × 12 （P03525） ZINC ION × 6	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 5	LAMBDA1 × 2 （P15024） SIGMA2 × 2 （P03525） ZINC ION × 1	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 25	LAMBDA1 × 10 （P15024） SIGMA2 × 10 （P03525） ZINC ION × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	MCE_REOVD
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–1289； UniProt 1–1289

LAMBDA1

OrganismNot specified

UniProt P15024

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 300	LAMBDA2 × 60 （P11079） SIGMA2 × 120 （P03525） ZINC ION × 60	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 5	LAMBDA2 × 1 （P11079） SIGMA2 × 2 （P03525） ZINC ION × 1	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 25	LAMBDA2 × 5 （P11079） SIGMA2 × 10 （P03525） ZINC ION × 5	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 30	LAMBDA2 × 6 （P11079） SIGMA2 × 12 （P03525） ZINC ION × 6	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 5	LAMBDA2 × 1 （P11079） SIGMA2 × 2 （P03525） ZINC ION × 1	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 25	LAMBDA2 × 5 （P11079） SIGMA2 × 10 （P03525） ZINC ION × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VL1_REOVD
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–1275； UniProt 1–1275 Author chain C； PDBConstruct 1–1275； UniProt 1–1275

SIGMA2

OrganismNot specified

UniProt P03525

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 300	LAMBDA2 × 60 （P11079） LAMBDA1 × 120 （P15024） ZINC ION × 60	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 5	LAMBDA2 × 1 （P11079） LAMBDA1 × 2 （P15024） ZINC ION × 1	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 25	LAMBDA2 × 5 （P11079） LAMBDA1 × 10 （P15024） ZINC ION × 5	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 30	LAMBDA2 × 6 （P11079） LAMBDA1 × 12 （P15024） ZINC ION × 6	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 5	LAMBDA2 × 1 （P11079） LAMBDA1 × 2 （P15024） ZINC ION × 1	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 25	LAMBDA2 × 5 （P11079） LAMBDA1 × 10 （P15024） ZINC ION × 5	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VSI2_REOVD
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain D； PDBConstruct 1–418； UniProt 1–418 Author chain E； PDBConstruct 1–418； UniProt 1–418

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1ej6
Deposition date deposition_date	2000-02-29
Structure title title	Reovirus core
Keywords keywords	virus, icosahedral, non-equivalence, dsRNA virus, methylase, methyltransferase, guanylyltransferase, zinc finger, Icosahedral virus; VIRUS
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1ej6__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1ej6__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1ej6__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	287.90 Å
Total Rg	287.80 Å
Atom count	2069160
Residues	262140
Excluded volume	36778000 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1ej6__assembly_1__model_1`	complete icosahedral assembly （300）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`1ej6__assembly_2__model_1`	pentameric （5）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
3	1	`1ej6__assembly_3__model_1`	25-meric （25）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
4	1	`1ej6__assembly_4__model_1`	30-meric （30）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
5	1	`1ej6__assembly_5__model_1`	pentameric （5）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
6	1	`1ej6__assembly_6__model_1`	25-meric （25）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	LAMBDA2
Molecular weight formula_weight	144098.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	34487

MANVWGVRLADSLSSPTIETRTRQYTLHDLCSDLDANPGREPWKPLRNQRTNNIVAVQLFRPLQGLVLDTQLYGFPGAFDDWERFMREKLRVLKYEVLRIYPISNYSNEHVNVFVANALVGAFLSNQAFYDLLPLLIINDTMIGDLLGTGASLSQFFQSHGDVLEVAAGRKYLQMENYSNDDDDPPLFAKDLSDYAKAFYSDTYEVLDRFFWTHDSSAGVLVHYDKPTNGHHYLLGTLTQMVSAPPYIINATDAMLLESCLEQFSANVRARPAQPVTRLDQCYHLRWGAQYVGEDSLTYRLGVLSLLATNGYQLARPIPRQLTNRWLSSFVSQIMSDGVNETPLWPQERYVQIAYDSPSVVDGATQYGYVRKNQLRLGMRISALQSLSDTPSPVQWLPQYTIDQAAMDEGDLMVSRLTQLPLRPDYGNIWVGDALSYYVDYNRSHRVVLSSELPQLPDTYFDGDEQYGRSLFSLARKIGDRSLVKDTAVLKHAYQAIDPNTGKEYLRSRQSVAYFGASAGHSGADQPLVIEPWIQGKISGVPPPSSVRQFGYDVARGAIVDLARPFPSGDYQFVYSDVDQVVDGHDDLSISSGLVESLLSSCMHATAPGGSFVVKINFPTRPVWHYIEQKILPNITSYMLIKPFVTNNVELFFVAFGVHQHSSLTWTSGVYFFLVDHFYRYETLSTISRQLPSFGYVDDGSSVTGIETISIENPGFSNMTQAARIGISGLCANVGNARKSIAIYESHGARVLTITSRRSPASARRKSRLRYLPLIDPRSLEVQARTILPADPVLFENVSGASPHVCLTMMYNFEVSSAVYDGDVVLDLGTGPEAKILELIPATSPVTCVDIRPTAQPSGCWNVRTTFLELDYLSDGWITGVRGDIVTCMLSLGAAAAGKSMTFDAAFQQLIKVLSKSTANVVLVQVNCPTDVVRSIKGYLEIDSTNKRYRFPKFGRDEPYSDMDALEKICRTAWPNCSITWVPLSYDLRWTRLALLESTTLSSASIRIAELMYKYMPIMRIDIHGLPMEKRGNFIVGQNCSLVIPGFNAQDVFNCYFNSALAFSTEDVNAAMIPQVSAQFDATKGEWTLDMVFSDAGIYTMQALVGSNANPVSLGSFVVDSPDVDITDAWPAQLDFTIAGTDVDITVNPYYRLMTFVRIDGQWQIANPDKFQFFSSASGTLVMNVKLDIADKYLLYYIRDVQSRDVGFYIQHPLQLLNTITLPTNEDLFLSAPDMREWAVKESGNTICILNSQGFVLPQDWDVLTDTISWSPSIPTYIVPPGDYTLTPL

Entity 2 Entity 2 polymer

Description description	LAMBDA1
Molecular weight formula_weight	142008.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,C

MKRIPRKTKGKSSGKGNDSTERSDDGSSQLRDKQNNKAGPATTEPGTSNREQYRARPGIASVQRATESAELPMKNNDEGTPDKKGNTRGDLVNEHSEAKDEADEATQKQAKDTDKSKAQVTYSDTGINNANELSRSGNVDNEGGSNQKPMSTRIAEATSAIVSKHPARVGLPPTASSGHGYQCHVCSAVLFSPLDLDAHVASHGLHGNMTLTSSEIQRHITEFISSWQNHPIVQVSADVENKKTAQLLHADTPRLVTWDAGLCTSFKIVPIVPAQVPQDVLAYTFFTSSYAIQSPFPEAAVSRIVVHTRWASNVDFDRDSSVIMAPPTENNIHLFKQLLNTETLSVRGANPLMFRANVLHMLLEFVLDNLYLNRHTGFSQDHTPFTEGANLRSLPGPDAEKWYSIMYPTRMGTPNVSKICNFVASCVRNRVGRFDRAQMMNGAMSEWVDVFETSDALTVSIRGRWMARLARMNINPTEIEWALTECAQGYVTVTSPYAPSVNRLMPYRISNAERQISQIIRIMNIGNNATVIQPVLQDISVLLQRISPLQIDPTIISNTMSTVSESTTQTLSPASSILGKLRPSNSDFSSFRVALAGWLYNGVVTTVIDDSSYPKDGGSVTSLENLWDFFILALALPLTTDPCAPVKAFMTLANMMVGFETIPMDNQIYTQSRRASAFSTPHTWPRCFMNIQLISPIDAPILRQWAEIIHRYWPNPSQIRYGAPNVFGSANLFTPPEVLLLPIDHQPANVTTPTLDFTNELTNWRARVCELMKNLVDNQRYQPGWTQSLVSSMRGTLDKLKLIKSMTPMYLQQLAPVELAVIAPMLPFPPFQVPYVRLDRDRVPTMVGVTRQSRDTITQPALSLSTTNTTVGVPLALDARAITVALLSGKYPPDLVTNVWYADAIYPMYADTEVFSNLQRDMITCEAVQTLVTLVAQISETQYPVDRYLDWIPSLRASAATAATFAEWVNTSMKTAFDLSDMLLEPLLSGDPRMTQLAIQYQQYNGRTFNVIPEMPGSVIADCVQLTAEVFNHEYNLFGIARGDIIIGRVQSTHLWSPLAPPPDLVFDRDTPGVHIFGRDCRISFGMNGAAPMIRDETGMMVPFEGNWIFPLALWQMNTRYFNQQFDAWIKTGELRIRIEMGAYPYMLHYYDPRQYANAWNLTSAWLEEITPTSIPSVPFMVPISSDHDISSAPAVQYIISTEYNDRSLFCTNSSSPQTIAGPDKHIPVERYNILTNPDAPPTQIQLPEVVDLYNVVTRYAYETPPITAVVMGVP

Entity 3 Entity 3 polymer

Description description	SIGMA2
Molecular weight formula_weight	47155.2 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,E

MARAAFLFKTVGFGGLQNVPINDELSSHLLRAGNSPWQLTQFLDWISLGRGLATSALVPTAGSRYYQMSCLLSGTLQIPFRPNHRWGDIRFLRLVWSAPTLDGLVVAPPQVLAQPALQAQADRVYDCDDYPFLARDPRFKHRVYQQLSAVTLLNLTGFGPISYVRVDEDMWSGDVNQLLMNYFGHTFAEIAYTLCQASANRPWEHDGTYARMTQIILSLFWLSYVGVIHQQNTYRTFYFQCNRRGDAAEVWILSCSLNHSAQIRPGNRSLFVMPTSPDWNMDVNLILSSTLTGCLCSGSQLPLIDNNSVPAVSRNIHGWTGRAGNQLHGFQVRRMVTEFCDRLRRDGVMTQAQQNQIEALADQTQQFKRDKLEAWAREDDQYNQANPNSTMFRTKPFTNAQWGRGNTGATSAAIAALI

Entity 4 Entity 4 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	1

▼

6. Fold Classification (SCOP + CATH) 14 domains

SCOP 2.08 (5 domains)

Domain ID domain_id	d1ej6a_
Class class	i — Low resolution protein structures
Fold Fold fold	i.7 — Reovirus components
Superfamily Superfamily superfamily	i.7.1 — Reovirus components
Family Family family	i.7.1.1 — Reovirus components

Domain ID domain_id	d1ej6b_
Class class	i — Low resolution protein structures
Fold Fold fold	i.7 — Reovirus components
Superfamily Superfamily superfamily	i.7.1 — Reovirus components
Family Family family	i.7.1.1 — Reovirus components

Domain ID domain_id	d1ej6c_
Class class	i — Low resolution protein structures
Fold Fold fold	i.7 — Reovirus components
Superfamily Superfamily superfamily	i.7.1 — Reovirus components
Family Family family	i.7.1.1 — Reovirus components

Domain ID domain_id	d1ej6d_
Class class	i — Low resolution protein structures
Fold Fold fold	i.7 — Reovirus components
Superfamily Superfamily superfamily	i.7.1 — Reovirus components
Family Family family	i.7.1.1 — Reovirus components

Domain ID domain_id	d1ej6e_
Class class	i — Low resolution protein structures
Fold Fold fold	i.7 — Reovirus components
Superfamily Superfamily superfamily	i.7.1 — Reovirus components
Family Family family	i.7.1.1 — Reovirus components

CATH v4.4 (9 domains)

Domain ID domain_id	1ej6A01
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1810 — Reovirus components fold
Homologous superfamily homologous superfamily	10 — Reovirus components

Domain ID domain_id	1ej6A02
Class class	3 — Alpha Beta
Architecture architecture	55 — 3-Layer(bab) Sandwich
Topology topology	60 — Reovirus components fold
Homologous superfamily homologous superfamily	10 — Reovirus components

Domain ID domain_id	1ej6A03
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	10760 — Reovirus core

Domain ID domain_id	1ej6A04
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	150 — Vaccinia Virus protein VP39

Domain ID domain_id	1ej6A05
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	1ej6B00
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1830 — Inner capsid protein lambda-1
Homologous superfamily homologous superfamily	10 — Inner capsid protein lambda-1

Domain ID domain_id	1ej6C00
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1830 — Inner capsid protein lambda-1
Homologous superfamily homologous superfamily	10 — Inner capsid protein lambda-1

Domain ID domain_id	1ej6D02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	1520 —

Domain ID domain_id	1ej6E02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	1520 —

▶

Unit-cell length a length_a	1255.000 Å
Unit-cell length b length_b	1255.000 Å
Unit-cell length c length_c	1255.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	960

Space group space_group	F 4 3 2
Space-group number int_tables_number	209
Crystal system crystal_system	—

Resolution resolution	3.600 Å
Low-resolution limit resolution_low	20.000 Å
R factor r_factor	0.2081
R_work r_work	0.2059
R_free r_free	0.2081

Reovirus core

1. Protein Identity and Related Structures Protein Identity & Related Structures

LAMBDA2

State in the Current Structure

Other States of the Same Protein in the Database

LAMBDA1

State in the Current Structure

Other States of the Same Protein in the Database

SIGMA2

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1ej6__assembly_1__model_1

1ej6__assembly_1__model_1 | I(q)

1ej6__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 non-polymer

6. Fold Classification (SCOP + CATH) 14 domains

SCOP 2.08 (5 domains)

CATH v4.4 (9 domains)

7. Citations (1)

Reovirus core

1. Protein Identity and Related Structures Protein Identity & Related Structures

LAMBDA2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

LAMBDA1

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

SIGMA2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1ej6__assembly_1__model_1

1ej6__assembly_1__model_1 | I(q)

1ej6__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 non-polymer

6. Fold Classification (SCOP + CATH) 14 domains

SCOP 2.08 (5 domains)

CATH v4.4 (9 domains)

7. Citations (1)