SAXSdb — 9cyt

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Outer capsid protein lambda-2

OrganismNot specified

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 10 PDB declaration: decameric（10） Consistent with protein copy count	Chain J； UniProt 1–1289	Not recorded	Outer capsid protein mu-1N × 6 （P11078） Outer capsid protein sigma-3 × 3 （P03527）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4；Phosphate-buffered saline cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.70 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 9CYT	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1EJ6 Reovirus core Deposited 2000-02-29	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 300 PDB declaration: complete icosahedral assembly	Chain A 1–1289（1289 aa）	Not recorded	ZN ZINC ION × 60	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；sodium chloride, sodium acetate, magnesium chloride, hepes, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.60 Å R-free 0.208
1EJ6 Reovirus core Deposited 2000-02-29	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain A 1–1289（1289 aa）	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；sodium chloride, sodium acetate, magnesium chloride, hepes, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.60 Å R-free 0.208
1EJ6 Reovirus core Deposited 2000-02-29	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 25 PDB declaration: 25-meric	Chain A 1–1289（1289 aa）	Not recorded	ZN ZINC ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；sodium chloride, sodium acetate, magnesium chloride, hepes, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.60 Å R-free 0.208
1EJ6 Reovirus core Deposited 2000-02-29	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain A 1–1289（1289 aa）	Not recorded	ZN ZINC ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；sodium chloride, sodium acetate, magnesium chloride, hepes, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.60 Å R-free 0.208
1EJ6 Reovirus core Deposited 2000-02-29	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain A 1–1289（1289 aa）	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；sodium chloride, sodium acetate, magnesium chloride, hepes, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.60 Å R-free 0.208
1EJ6 Reovirus core Deposited 2000-02-29	Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 25 PDB declaration: 25-meric	Chain A 1–1289（1289 aa）	Not recorded	ZN ZINC ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；sodium chloride, sodium acetate, magnesium chloride, hepes, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 3.60 Å R-free 0.208
2CSE Features of Reovirus Outer-Capsid Protein mu1 Revealed by Electron and Image Reconstruction of the virion at 7.0-A Resolution Deposited 2005-05-21	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 1620 PDB declaration: 1620-MERIC	Chain U 1–1289（1289 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 10 mM TRIS；pH 7.5；10 mM TRIS cryo-EM vitrification conditions Cryogen ETHANE；PLUNGED INTO ETHANE	Resolution 7.00 Å
2CSE Features of Reovirus Outer-Capsid Protein mu1 Revealed by Electron and Image Reconstruction of the virion at 7.0-A Resolution Deposited 2005-05-21	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain U 1–1289（1289 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 10 mM TRIS；pH 7.5；10 mM TRIS cryo-EM vitrification conditions Cryogen ETHANE；PLUNGED INTO ETHANE	Resolution 7.00 Å
2CSE Features of Reovirus Outer-Capsid Protein mu1 Revealed by Electron and Image Reconstruction of the virion at 7.0-A Resolution Deposited 2005-05-21	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 135 PDB declaration: 135-meric	Chain U 1–1289（1289 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 10 mM TRIS；pH 7.5；10 mM TRIS cryo-EM vitrification conditions Cryogen ETHANE；PLUNGED INTO ETHANE	Resolution 7.00 Å
2CSE Features of Reovirus Outer-Capsid Protein mu1 Revealed by Electron and Image Reconstruction of the virion at 7.0-A Resolution Deposited 2005-05-21	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 162 PDB declaration: 162-meric	Chain U 1–1289（1289 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 10 mM TRIS；pH 7.5；10 mM TRIS cryo-EM vitrification conditions Cryogen ETHANE；PLUNGED INTO ETHANE	Resolution 7.00 Å
2CSE Features of Reovirus Outer-Capsid Protein mu1 Revealed by Electron and Image Reconstruction of the virion at 7.0-A Resolution Deposited 2005-05-21	Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 27 PDB declaration: 27-meric	Chain U 1–1289（1289 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 10 mM TRIS；pH 7.5；10 mM TRIS cryo-EM vitrification conditions Cryogen ETHANE；PLUNGED INTO ETHANE	Resolution 7.00 Å
6ZTZ Assembly intermediates of orthoreovirus captured in the cell Deposited 2020-07-20	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 11 PDB declaration: undecameric	Chain O 2–1289（1288 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7 cryo-EM vitrification conditions Cryogen NITROGEN	Resolution 6.50 Å
9CYX Cryo-EM structure of MRV full core Deposited 2024-08-02	Different construct Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 2–1289（1288 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；Phosphate-buffered saline cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
9CYY Cryo-EM structure of MRV virion Deposited 2024-08-03	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain J 1–1289（1289 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；Phosphate-buffered saline cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å

5 other PDB entries and 14 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	LMBD2_REOVD
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain J； PDBConstruct 1–1289； UniProt 1–1289

Outer capsid protein mu-1N

OrganismNot specified

UniProt P11078

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 10 PDB declaration: decameric（10） Consistent with protein copy count	Chain A； UniProt 1–708 Chain B； UniProt 1–708 Chain D； UniProt 1–708 Chain E； UniProt 1–708 Chain F； UniProt 1–708 Chain H； UniProt 1–708	Not recorded	Outer capsid protein lambda-2 × 1 （P11079） Outer capsid protein sigma-3 × 3 （P03527）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4；Phosphate-buffered saline cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.70 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 9CYT	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
9CYY Cryo-EM structure of MRV virion Deposited 2024-08-03	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain A 1–708（708 aa） Chain B 1–708（708 aa） Chain D 1–708（708 aa） Chain E 1–708（708 aa） Chain F 1–708（708 aa） Chain H 1–708（708 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；Phosphate-buffered saline cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å

1 other PDB entries and 1 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	MU1_REOVD
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain A； PDBConstruct 1–708； UniProt 1–708 Author chain B； PDBConstruct 1–708； UniProt 1–708 Author chain D； PDBConstruct 1–708； UniProt 1–708 Author chain E； PDBConstruct 1–708； UniProt 1–708 Author chain F； PDBConstruct 1–708； UniProt 1–708 Author chain H； PDBConstruct 1–708； UniProt 1–708

Outer capsid protein sigma-3

OrganismNot specified

UniProt P03527

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 10 PDB declaration: decameric（10） Consistent with protein copy count	Chain G； UniProt 1–365 Chain I； UniProt 1–365 Chain L； UniProt 1–365	Not recorded	Outer capsid protein lambda-2 × 1 （P11079） Outer capsid protein mu-1N × 6 （P11078）	ELECTRON MICROSCOPY cryo-EM buffer：pH 7.4；Phosphate-buffered saline cryo-EM vitrification conditions：Cryogen ETHANE	Resolution 3.70 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 9CYT	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
7LUP Human TRiC/CCT complex with reovirus outer capsid protein sigma-3 Deposited 2021-02-22	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 17 PDB declaration: heptadecameric	Chain Q 1–365（365 aa）	Not recorded	ZN ZINC ION × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.5 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 6.20 Å
9CYY Cryo-EM structure of MRV virion Deposited 2024-08-03	Different oligomeric state Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 29 PDB declaration: 29-meric	Chain G 1–365（365 aa） Chain I 1–365（365 aa） Chain L 1–365（365 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4；Phosphate-buffered saline cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å

2 other PDB entries and 2 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	SIGM3_REOVD
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain G； PDBConstruct 1–365； UniProt 1–365 Author chain I； PDBConstruct 1–365； UniProt 1–365 Author chain L； PDBConstruct 1–365； UniProt 1–365

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	9cyt
Deposition date deposition_date	2024-08-02
最后修订 last_revision	2024-12-18
Structure title title	Cryo-EM structure of MRV outer shell
Keywords keywords	Mammalian reovirus, outer shell, VIRAL PROTEIN; VIRAL PROTEIN
Experimental Method method	ELECTRON MICROSCOPY

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	59.02 Å
Radius of gyration Rg (electron density) rg_electron	58.93 Å
Forward intensity I(0) i0	3274020000.00
Molecular weight molecular_weight	483320.0 kDa
Excluded volume excluded_volume	605630 Å³
Envelope volume envelope_volume	875170 Å³
Hydration-shell volume shell_volume	123150 Å³
Envelope diameter envelope_diameter	207.0 Å
Shell Rg shell_rg	60.72 Å
Envelope Rg envelope_rg	58.97 Å
Shape Rg shape_rg	58.99 Å
Total Rg total_rg	58.75 Å
Total atoms total_atoms	33991
Residues n_residues	4390
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	203.4 Å
Rg (real space) rg_real	59.08 Å
Rg uncertainty (real space) rg_real_error	1.92 Å
I(0) (real space) i0_real	3.2740e+09
I(0) uncertainty (real space) i0_real_error	7.1230e+07
Rg (reciprocal space) rg_reciprocal	58.96 Å
I(0) (reciprocal space) i0_reciprocal	3273000000.0000
Solution quality estimate total_estimate	0.6336
Solution quality rating solution_quality	REASONABLE a REASONABLE solution
P(r) peaks n_peaks	1
Primary peak position r_peak_primary	67.8 Å
Skewness Skewness skewness	0.384
Kurtosis Kurtosis kurtosis	-0.269
Angular range angular_range	— – 0.1350 Å⁻¹
Current regularization parameter α current_alpha	0.0001
Highest regularization parameter α highest_alpha	275500000.0000
Real-space data points n_real_points	28
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.824; Stabil: 1.000; Sysdev: 0.009; Positv: 1.000; Valcen: 0.998; Smooth: 0.733

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Outer capsid protein lambda-2
Molecular weight formula_weight	144098.8 kDa
EC 编号 ec_number	2.7.7.50,2.1.1.56
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J
Atom count atom_count	33991

MANVWGVRLADSLSSPTIETRTRQYTLHDLCSDLDANPGREPWKPLRNQRTNNIVAVQLFRPLQGLVLDTQLYGFPGAFDDWERFMREKLRVLKYEVLRIYPISNYSNEHVNVFVANALVGAFLSNQAFYDLLPLLIINDTMIGDLLGTGASLSQFFQSHGDVLEVAAGRKYLQMENYSNDDDDPPLFAKDLSDYAKAFYSDTYEVLDRFFWTHDSSAGVLVHYDKPTNGHHYLLGTLTQMVSAPPYIINATDAMLLESCLEQFSANVRARPAQPVTRLDQCYHLRWGAQYVGEDSLTYRLGVLSLLATNGYQLARPIPRQLTNRWLSSFVSQIMSDGVNETPLWPQERYVQIAYDSPSVVDGATQYGYVRKNQLRLGMRISALQSLSDTPSPVQWLPQYTIDQAAMDEGDLMVSRLTQLPLRPDYGNIWVGDALSYYVDYNRSHRVVLSSELPQLPDTYFDGDEQYGRSLFSLARKIGDRSLVKDTAVLKHAYQAIDPNTGKEYLRSRQSVAYFGASAGHSGADQPLVIEPWIQGKISGVPPPSSVRQFGYDVARGAIVDLARPFPSGDYQFVYSDVDQVVDGHDDLSISSGLVESLLSSCMHATAPGGSFVVKINFPTRPVWHYIEQKILPNITSYMLIKPFVTNNVELFFVAFGVHQHSSLTWTSGVYFFLVDHFYRYETLSTISRQLPSFGYVDDGSSVTGIETISIENPGFSNMTQAARIGISGLCANVGNARKSIAIYESHGARVLTITSRRSPASARRKSRLRYLPLIDPRSLEVQARTILPADPVLFENVSGASPHVCLTMMYNFEVSSAVYDGDVVLDLGTGPEAKILELIPATSPVTCVDIRPTAQPSGCWNVRTTFLELDYLSDGWITGVRGDIVTCMLSLGAAAAGKSMTFDAAFQQLIKVLSKSTANVVLVQVNCPTDVVRSIKGYLEIDSTNKRYRFPKFGRDEPYSDMDALEKICRTAWPNCSITWVPLSYDLRWTRLALLESTTLSSASIRIAELMYKYMPIMRIDIHGLPMEKRGNFIVGQNCSLVIPGFNAQDVFNCYFNSALAFSTEDVNAAMIPQVSAQFDATKGEWTLDMVFSDAGIYTMQALVGSNANPVSLGSFVVDSPDVDITDAWPAQLDFTIAGTDVDITVNPYYRLMTFVRIDGQWQIANPDKFQFFSSASGTLVMNVKLDIADKYLLYYIRDVQSRDVGFYIQHPLQLLNTITLPTNEDLFLSAPDMREWAVKESGNTICILNSQGFVLPQDWDVLTDTISWSPSIPTYIVPPGDYTLTPL

Entity 2 Entity 2 polymer

Description description	Outer capsid protein mu-1N
Molecular weight formula_weight	76334.3 kDa
Source method src_method	nat
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,D,F,E,H

MGNASSIVQTINVTGDGNVFKPSAETSSTAVPSLSLSPGMLNPGGVPWIAVGDETSVTSPGALRRMTSKDIPETAIINTDNSSGAVPSESALVPYIDEPLVVVTEHAITNFTKAEMALEFNREFLDKMRVLSVSPKYSDLLTYVDCYVGVSARQALNNFQKQVPVITPTRQTMYVDSIQAALKALEKWEIDLRVAQTLLPTNVPIGEVSCPMQSVVKLLDDQLPDDSLIRRYPKEAAVALAKRNGGIQWMDVSEGTVMNEAVNAVAASALAPSASAPPLEEKSKLTEQAMDLVTAAEPEIIASLAPVPAPVFAIPPKPADYNVRTLRIDEATWLRMIPKSMNTPFQIQVTDNTGTNWHLNLRGGTRVVNLDQIAPMRFVLDLGGKSYKETSWDPNGKKVGFIVFQSKIPFELWTAASQIGQATVVNYVQLYAEDSSFTAQSIIATTSLAYNYEPEQLNKTDPEMNYYLLATFIDSAAITPTNMTQPDVWDALLTMSPLSAGEVTVKGAVVSEVVPADLIGSYTPESLNASLPNDAARCMIDRASKIAEAIKIDDDAGPDEYSPNSVPIQGQLAISQLETGYGVRIFNPKGILSKIASRAMQAFIGDPSTIITQAAPVLSDKNNWIALAQGVKTSLRTKSLSAGVKTAVSKLSSSESIQNWTQGFLDKVSAHFPAPKPDCPTSGDSGESSNRRVKRDSYAGVVKRGYTR

Entity 3 Entity 3 polymer

Description description	Outer capsid protein sigma-3
Molecular weight formula_weight	41168.1 kDa
Source method src_method	nat
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,G,L

MEVCLPNGHQVVDLINNAFEGRVSIYSAQEGWDKTISAQPDMMVCGGAVVCMHCLGVVGSLQRKLKHLPHHRCNQQIRHQDYVDVQFADRVTAHWKRGMLSFVAQMHEMMNDVSPDDLDRVRTEGGSLVELNWLQVDPNSMFRSIHSSWTDPLQVVDDLDTKLDQYWTALNLMIDSSDLIPNFMMRDPSHAFNGVKLGGDARQTQFSRTFDSRSSLEWGVMVYDYSELEHDPSKGRAYRKELVTPARDFGHFGLSHYSRATTPILGKMPAVFSGMLTGNCKMYPFIKGTAKLKTVRKLVEAVNHAWGVEKIRYALGPGGMTGWYNRTMQQAPIVLTPAALTMFPDTIKFGDLNYPVMIGDPMILG

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	3.70 Å
Resolution测定方法 resolution_method	—
颗粒数 num_particles	8911

fit	/app/data/saxs_computation/cy/9cyt/9cyt.fit
pddf	/app/data/pr_computation/cy/9cyt/9cyt.pr.out
profile	/app/data/saxs_computation/cy/9cyt/9cyt.dat

Cryo-EM structure of MRV outer shell

1. Protein Identity and Related Structures Protein Identity & Related Structures

Outer capsid protein lambda-2

State in the Current Structure

Other States of the Same Protein in the Database

Outer capsid protein mu-1N

State in the Current Structure

Other States of the Same Protein in the Database

Outer capsid protein sigma-3

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

冷冻电镜 EM 3D

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)