SAXSdb — 1g13

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

GANGLIOSIDE M2 ACTIVATOR PROTEIN

Homo sapiens

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein monomer	Monomer	Protein 1	4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 1 water × 1	Consistent with protein count
2	Protein monomer	Monomer	Protein 1	water × 1	Consistent with protein count
3	Protein monomer	Monomer	Protein 1	water × 1	Consistent with protein count
4	Protein homooligomer	Homooligomer	Protein 2	4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SAP3_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–162； UniProt 39–200 Author chain B； PDBConstruct 1–162； UniProt 39–200 Author chain C； PDBConstruct 1–162； UniProt 39–200

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1g13
Deposition date deposition_date	2000-10-10
Structure title title	HUMAN GM2 ACTIVATOR STRUCTURE
Keywords keywords	beta cup, Ligand Binding Protein; Ligand Binding Protein
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1g13__assembly_2__model_1

Assembly 2 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1g13__assembly_2__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1g13__assembly_2__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	17.44 Å
Rg (electron density)	16.20 Å
Total Rg	17.29 Å
Atom count	1232
Residues	160
Excluded volume	22282 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1g13__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`1g13__assembly_2__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`1g13__assembly_3__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`1g13__assembly_4__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	GANGLIOSIDE M2 ACTIVATOR PROTEIN
Molecular weight formula_weight	17698.1 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C
Atom count atom_count	4093

SSFSWDNCDEGKDPAVIRSLTLEPDPIIVPGNVTLSVMGSTSVPLSSPLKVDLVLEKEVAGLWIKIPCTDYIGSCTFEHFCDVLDMLIPTGEPCPEPLRTYGLPCHCPFKEGTYSLPKSEFVVPDLELPSWLTTGNYRIESVLSSSGKRLGCIKIAASLKGI

Source Source

Source organism organism	Homo sapiens
Common name common_name	human
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	4-(2-HYDROXYETHYL)-1-PIPERAZINE ETHANESULFONIC ACID
Molecular weight formula_weight	238.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	386

▼

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (3 domains)

Domain ID domain_id	d1g13a_
Class class	b — All beta proteins
Fold Fold fold	b.95 — Ganglioside M2 (gm2) activator
Superfamily Superfamily superfamily	b.95.1 — Ganglioside M2 (gm2) activator
Family Family family	b.95.1.1 — Ganglioside M2 (gm2) activator

Domain ID domain_id	d1g13b_
Class class	b — All beta proteins
Fold Fold fold	b.95 — Ganglioside M2 (gm2) activator
Superfamily Superfamily superfamily	b.95.1 — Ganglioside M2 (gm2) activator
Family Family family	b.95.1.1 — Ganglioside M2 (gm2) activator

Domain ID domain_id	d1g13c_
Class class	b — All beta proteins
Fold Fold fold	b.95 — Ganglioside M2 (gm2) activator
Superfamily Superfamily superfamily	b.95.1 — Ganglioside M2 (gm2) activator
Family Family family	b.95.1.1 — Ganglioside M2 (gm2) activator

CATH v4.4 (3 domains)

Domain ID domain_id	1g13A00
Class class	2 — Mainly Beta
Architecture architecture	70 — Distorted Sandwich
Topology topology	220 — Ganglioside M2 Activator Protein; Chain: A,
Homologous superfamily homologous superfamily	10 — Ganglioside GM2 activator

Domain ID domain_id	1g13B00
Class class	2 — Mainly Beta
Architecture architecture	70 — Distorted Sandwich
Topology topology	220 — Ganglioside M2 Activator Protein; Chain: A,
Homologous superfamily homologous superfamily	10 — Ganglioside GM2 activator

Domain ID domain_id	1g13C00
Class class	2 — Mainly Beta
Architecture architecture	70 — Distorted Sandwich
Topology topology	220 — Ganglioside M2 Activator Protein; Chain: A,
Homologous superfamily homologous superfamily	10 — Ganglioside GM2 activator

▶

Unit-cell length a length_a	63.420 Å
Unit-cell length b length_b	85.630 Å
Unit-cell length c length_c	120.070 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	12

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	2.000 Å
Low-resolution limit resolution_low	6.000 Å
R factor r_factor	—
R_work r_work	0.2150
R_free r_free	0.2580

HUMAN GM2 ACTIVATOR STRUCTURE

1. Protein Identity and Related Structures Protein Identity & Related Structures

GANGLIOSIDE M2 ACTIVATOR PROTEIN

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1g13__assembly_2__model_1

1g13__assembly_2__model_1 | I(q)

1g13__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (3 domains)

CATH v4.4 (3 domains)

7. Citations (2)

HUMAN GM2 ACTIVATOR STRUCTURE

1. Protein Identity and Related Structures Protein Identity & Related Structures

GANGLIOSIDE M2 ACTIVATOR PROTEIN

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1g13__assembly_2__model_1

1g13__assembly_2__model_1 | I(q)

1g13__assembly_2__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (3 domains)

CATH v4.4 (3 domains)

7. Citations (2)