SAXSdb — 1hia

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

KALLIKREIN

Sus scrofa

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	HIRUSTASIN × 1 （P80302） water × 3	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 3	HIRUSTASIN × 1 （P80302） water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	KLK_PIG
Isoform	—
PDB entities	1, 2
Chains and sequence ranges	Author chain A； PDBConstruct 1–78； UniProt 8–87 Author chain X； PDBConstruct 1–78； UniProt 8–87 Author chain B； PDBConstruct 1–149； UniProt 95–246 Author chain Y； PDBConstruct 1–149； UniProt 95–246

HIRUSTASIN

Hirudo medicinalis

UniProt P80302

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	KALLIKREIN × 1 （P00752） KALLIKREIN × 1 （P00752） water × 3	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 3	KALLIKREIN × 1 （P00752） KALLIKREIN × 1 （P00752） water × 3	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	ANTA_HIRME
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain I； PDBConstruct 1–48； UniProt 5–52 Author chain J； PDBConstruct 1–48； UniProt 5–52

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1hia
Deposition date deposition_date	1996-12-12
Structure title title	KALLIKREIN COMPLEXED WITH HIRUSTASIN
Keywords keywords	COMPLEX (PROTEASE-INHIBITOR), TISSUE KALLIKREIN, SERINE PROTEASE, TRYPSIN, PSA, KININ, SERPIN, COMPLEX (PROTEASE-INHIBITOR) complex; COMPLEX (PROTEASE/INHIBITOR)
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1hia__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1hia__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1hia__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	19.10 Å
Rg (electron density)	18.02 Å
Total Rg	19.02 Å
Atom count	2140
Residues	278
Excluded volume	37718 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1hia__assembly_1__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`1hia__assembly_2__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	KALLIKREIN
Molecular weight formula_weight	9119.1 kDa
EC 编号 ec_number	3.4.21.35
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,X
Atom count atom_count	4584

IIGGRECEKNSHPWQVAIYHYSSFQCGGVLVNPKWVLTAAHCKNDNYEVWLGRHNLFENENTAQFFGVTADFPHPGFNLS

Source Source

Source organism organism	Sus scrofa
Common name common_name	pig
NCBI taxonomy ID ncbi_taxonomy_id	9823

Entity 2 Entity 2 polymer

Description description	KALLIKREIN
Molecular weight formula_weight	16511.5 kDa
EC 编号 ec_number	3.4.21.35
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,Y

ADGKDYSHDLMLLRLQSPAKITDAVKVLELPTQEPELGSTCEASGWGSIEPGPDDFEFPDEIQCVQLTLLQNTFCADAHPDKVTESMLCAGYLPGGKDTCMGDSGGPLICNGMWQGITSWGHTPCGSANKPSIYTKLIFYLDWIDDTITENP

Source Source

Source organism organism	Sus scrofa
Common name common_name	pig
NCBI taxonomy ID ncbi_taxonomy_id	9823

Entity 3 Entity 3 polymer

Description description	HIRUSTASIN
Molecular weight formula_weight	5200.1 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,J

TCGGETCSAAQVCLKGKCVCNEVHCRIRCKYGLKKDENGCEYPCSCAK

Source Source

Source organism organism	Hirudo medicinalis
Common name common_name	medicinal leech
NCBI taxonomy ID ncbi_taxonomy_id	6421

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	304

▼

6. Fold Classification (SCOP + CATH) 10 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d1hia.1
Class class	b — All beta proteins
Fold Fold fold	b.47 — Trypsin-like serine proteases
Superfamily Superfamily superfamily	b.47.1 — Trypsin-like serine proteases
Family Family family	b.47.1.2 — Eukaryotic proteases

Domain ID domain_id	d1hia.2
Class class	b — All beta proteins
Fold Fold fold	b.47 — Trypsin-like serine proteases
Superfamily Superfamily superfamily	b.47.1 — Trypsin-like serine proteases
Family Family family	b.47.1.2 — Eukaryotic proteases

Domain ID domain_id	d1hiai_
Class class	g — Small proteins
Fold Fold fold	g.3 — Knottins (small inhibitors, toxins, lectins)
Superfamily Superfamily superfamily	g.3.15 — Leech antihemostatic proteins
Family Family family	g.3.15.1 — Huristasin-like

Domain ID domain_id	d1hiaj_
Class class	g — Small proteins
Fold Fold fold	g.3 — Knottins (small inhibitors, toxins, lectins)
Superfamily Superfamily superfamily	g.3.15 — Leech antihemostatic proteins
Family Family family	g.3.15.1 — Huristasin-like

CATH v4.4 (6 domains)

Domain ID domain_id	1hiaA00
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	10 — Thrombin, subunit H
Homologous superfamily homologous superfamily	10 — Trypsin-like serine proteases

Domain ID domain_id	1hiaB00
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	10 — Thrombin, subunit H
Homologous superfamily homologous superfamily	10 — Trypsin-like serine proteases

Domain ID domain_id	1hiaI00
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	22 — Antistasin; domain 1
Homologous superfamily homologous superfamily	10 — Antistasin; domain 1

Domain ID domain_id	1hiaJ00
Class class	2 — Mainly Beta
Architecture architecture	10 — Ribbon
Topology topology	22 — Antistasin; domain 1
Homologous superfamily homologous superfamily	10 — Antistasin; domain 1

Domain ID domain_id	1hiaX00
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	10 — Thrombin, subunit H
Homologous superfamily homologous superfamily	10 — Trypsin-like serine proteases

Domain ID domain_id	1hiaY00
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	10 — Thrombin, subunit H
Homologous superfamily homologous superfamily	10 — Trypsin-like serine proteases

▶

Unit-cell length a length_a	116.900 Å
Unit-cell length b length_b	86.000 Å
Unit-cell length c length_c	69.400 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 21 21 2
Space-group number int_tables_number	18
Crystal system crystal_system	—

Resolution resolution	2.400 Å
Low-resolution limit resolution_low	8.000 Å
R factor r_factor	0.2050
R_work r_work	0.2050
R_free r_free	0.3110

KALLIKREIN COMPLEXED WITH HIRUSTASIN

1. Protein Identity and Related Structures Protein Identity & Related Structures

KALLIKREIN

State in the Current Structure

Other States of the Same Protein in the Database

HIRUSTASIN

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1hia__assembly_1__model_1

1hia__assembly_1__model_1 | I(q)

1hia__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 10 domains

SCOP 2.08 (4 domains)

CATH v4.4 (6 domains)

7. Citations (2)

KALLIKREIN COMPLEXED WITH HIRUSTASIN

1. Protein Identity and Related Structures Protein Identity & Related Structures

KALLIKREIN

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

HIRUSTASIN

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1hia__assembly_1__model_1

1hia__assembly_1__model_1 | I(q)

1hia__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 10 domains

SCOP 2.08 (4 domains)

CATH v4.4 (6 domains)

7. Citations (2)