SAXSdb — 1jch

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

COLICIN E3

Escherichia coli str. K12 substr.

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 4 PDB declaration: tetrameric（4） Consistent with protein copy count	Chain A； UniProt 1–551 Chain C； UniProt 1–551	Not recorded	COLICIN E3 IMMUNITY PROTEIN × 2 （P02984） CIT CITRIC ACID × 4 GOL GLYCEROL × 4	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 5.6；277 K；SODIUM CITRATE, CADMIUM ACETATE, ph 5.6, VAPOR DIFFUSION, HANGING DROP at 277K	Resolution 3.02 Å R-free 0.283
2	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 1–551	Not recorded	COLICIN E3 IMMUNITY PROTEIN × 1 （P02984） CIT CITRIC ACID × 2 GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 5.6；277 K；SODIUM CITRATE, CADMIUM ACETATE, ph 5.6, VAPOR DIFFUSION, HANGING DROP at 277K	Resolution 3.02 Å R-free 0.283
3	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain C； UniProt 1–551	Not recorded	COLICIN E3 IMMUNITY PROTEIN × 1 （P02984） CIT CITRIC ACID × 2 GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 5.6；277 K；SODIUM CITRATE, CADMIUM ACETATE, ph 5.6, VAPOR DIFFUSION, HANGING DROP at 277K	Resolution 3.02 Å R-free 0.283

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 1JCH	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1E44 ribonuclease domain of colicin E3 in complex with its immunity protein Deposited 2000-06-28	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 456–551（96 aa） Fragment：RIBONUCLEASE DOMAIN RESIDUES 456-551	Not recorded	EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.6；0.1 M NA CITRATE PH 5.6, 20% ISOPROPANOL, 10% PEG 4000	Resolution 2.40 Å R-free 0.228
1UJW Structure of the complex between BtuB and Colicin E3 Receptor binding domain Deposited 2003-08-12	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 314–448（135 aa） Fragment：R-domain(residues 314-448)	Not recorded	GP1 2-amino-2-deoxy-1-O-phosphono-alpha-D-glucopyranose × 2 LIM 3-OXO-PENTADECANOIC ACID × 2 LDA LAURYL DIMETHYLAMINE-N-OXIDE × 7 AAE ACETOACETIC ACID × 1 GOL GLYCEROL × 8	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.75 Å R-free 0.293
2B5U Crystal Structure Of Colicin E3 V206C Mutant In Complex With Its Immunity Protein Deposited 2005-09-29	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–551（551 aa）	Mutation：V206C	CIT CITRIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 5.6；277 K；Sodium citrate, pH 5.6, VAPOR DIFFUSION, temperature 277K	Resolution 2.30 Å R-free 0.295
2B5U Crystal Structure Of Colicin E3 V206C Mutant In Complex With Its Immunity Protein Deposited 2005-09-29	Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 1–551（551 aa）	Mutation：V206C	CIT CITRIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 5.6；277 K；Sodium citrate, pH 5.6, VAPOR DIFFUSION, temperature 277K	Resolution 2.30 Å R-free 0.295
4UDM Crystal structure of Im3 in complex with Y52A mutant of E3RNase Deposited 2014-12-10	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 456–551（96 aa） Fragment：RIBONUCLEASE DOMAIN, UNP RESIDUES 456-551	Mutation：YES	CA CALCIUM ION × 3 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.5；0.1M BIS-TRIS PH 6.5, 50MM CACL2,30%PEG550MME	Resolution 2.96 Å R-free 0.214
4V5K Structure of cytotoxic domain of colicin E3 bound to the 70S ribosome Deposited 2010-05-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 52 PDB declaration: 58-meric	Chain AY 455–551（97 aa） Fragment：RESIDUES 455-551	Mutation：YES	MG MAGNESIUM ION × 1164 ZN ZINC ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.18；AS STATED IN STRUCTURE OF THE 70S RIBOSOME COMPLEXED WITH MRNA AND TRNA. (2006) SCIENCE 313: 1935, PH 7.18	Resolution 3.20 Å R-free 0.270
4V5K Structure of cytotoxic domain of colicin E3 bound to the 70S ribosome Deposited 2010-05-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Heteromer；Protein × 52 PDB declaration: 58-meric	Chain CY 455–551（97 aa） Fragment：RESIDUES 455-551	Mutation：YES	MG MAGNESIUM ION × 1170 ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7.18；AS STATED IN STRUCTURE OF THE 70S RIBOSOME COMPLEXED WITH MRNA AND TRNA. (2006) SCIENCE 313: 1935, PH 7.18	Resolution 3.20 Å R-free 0.270

5 other PDB entries and 7 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	CEA3_ECOLI
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–551； UniProt 1–551 Author chain C； PDBConstruct 1–551； UniProt 1–551

COLICIN E3 IMMUNITY PROTEIN

Escherichia coli str. K12 substr.

UniProt P02984

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 4 PDB declaration: tetrameric（4） Consistent with protein copy count	Chain B； UniProt 1–84 Chain D； UniProt 1–84	Not recorded	COLICIN E3 × 2 （P00646） CIT CITRIC ACID × 4 GOL GLYCEROL × 4	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 5.6；277 K；SODIUM CITRATE, CADMIUM ACETATE, ph 5.6, VAPOR DIFFUSION, HANGING DROP at 277K	Resolution 3.02 Å R-free 0.283
2	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain B； UniProt 1–84	Not recorded	COLICIN E3 × 1 （P00646） CIT CITRIC ACID × 2 GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 5.6；277 K；SODIUM CITRATE, CADMIUM ACETATE, ph 5.6, VAPOR DIFFUSION, HANGING DROP at 277K	Resolution 3.02 Å R-free 0.283
3	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain D； UniProt 1–84	Not recorded	COLICIN E3 × 1 （P00646） CIT CITRIC ACID × 2 GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 5.6；277 K；SODIUM CITRATE, CADMIUM ACETATE, ph 5.6, VAPOR DIFFUSION, HANGING DROP at 277K	Resolution 3.02 Å R-free 0.283

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 1JCH	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1E44 ribonuclease domain of colicin E3 in complex with its immunity protein Deposited 2000-06-28	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–85（85 aa）	Not recorded	EDO 1,2-ETHANEDIOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.6；0.1 M NA CITRATE PH 5.6, 20% ISOPROPANOL, 10% PEG 4000	Resolution 2.40 Å R-free 0.228
2B5U Crystal Structure Of Colicin E3 V206C Mutant In Complex With Its Immunity Protein Deposited 2005-09-29	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–84（84 aa）	Not recorded	CIT CITRIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 5.6；277 K；Sodium citrate, pH 5.6, VAPOR DIFFUSION, temperature 277K	Resolution 2.30 Å R-free 0.295
2B5U Crystal Structure Of Colicin E3 V206C Mutant In Complex With Its Immunity Protein Deposited 2005-09-29	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 1–84（84 aa）	Not recorded	CIT CITRIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 5.6；277 K；Sodium citrate, pH 5.6, VAPOR DIFFUSION, temperature 277K	Resolution 2.30 Å R-free 0.295
3EIP CRYSTAL STRUCTURE OF COLICIN E3 IMMUNITY PROTEIN: AN INHIBITOR TO A RIBOSOME-INACTIVATING RNASE Deposited 1999-03-29	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 2–85（84 aa） Chain B 2–85（84 aa）	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6；2.0 M AMMONIUM SULFATE, 0.1 M MES BUFFER, PH 6.0, pH 6.00	Resolution 1.80 Å R-free 0.265
4UDM Crystal structure of Im3 in complex with Y52A mutant of E3RNase Deposited 2014-12-10	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–85（85 aa）	Not recorded	CA CALCIUM ION × 3 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.5；0.1M BIS-TRIS PH 6.5, 50MM CACL2,30%PEG550MME	Resolution 2.96 Å R-free 0.214

4 other PDB entries and 5 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	IMM3_ECOLI
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–84； UniProt 1–84 Author chain D； PDBConstruct 1–84； UniProt 1–84

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1jch
Deposition date deposition_date	2001-06-09
Structure title title	Crystal Structure of Colicin E3 in Complex with its Immunity Protein
Keywords keywords	;TRANSLOCATION DOMAIN IS A BETA-JELLYROLL, THE RECEPTOR-BINDING DOMAIN IS A COILED COIL, THE RNASE DOMAIN IS A SIX-STRANDED ANTIPARALLEL BETA-SHEET. THE IMMUNITY PROTEIN IS A FOUR-STRANDED ANTIPARALLEL BETA SHEET FLANKED BY 3 HELICES ON ONE SIDE OF THE SHEET, RIBOSOME INHIBITOR, HYDROLASE ;; RIBOSOME INHIBITOR, HYDROLASE
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	60.78 Å
Radius of gyration Rg (electron density) rg_electron	62.60 Å
Forward intensity I(0) i0	232468000.00
Molecular weight molecular_weight	122050.0 kDa
Excluded volume excluded_volume	150800 Å³
Envelope volume envelope_volume	250470 Å³
Hydration-shell volume shell_volume	37310 Å³
Envelope diameter envelope_diameter	192.7 Å
Shell Rg shell_rg	51.54 Å
Envelope Rg envelope_rg	60.19 Å
Shape Rg shape_rg	62.67 Å
Total Rg total_rg	62.06 Å
Total atoms total_atoms	8602
Residues n_residues	1104
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	182.2 Å
Rg (real space) rg_real	61.86 Å
Rg uncertainty (real space) rg_real_error	2.42 Å
I(0) (real space) i0_real	2.3250e+08
I(0) uncertainty (real space) i0_real_error	4.8390e+06
Rg (reciprocal space) rg_reciprocal	59.74 Å
I(0) (reciprocal space) i0_reciprocal	231600000.0000
Solution quality estimate total_estimate	0.6264
Solution quality rating solution_quality	REASONABLE a REASONABLE solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	35.0 Å
Skewness Skewness skewness	0.371
Kurtosis Kurtosis kurtosis	-1.117
Angular range angular_range	— – 0.1300 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	5471000.0000
Real-space data points n_real_points	27
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.327; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.160; Smooth: 0.000

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	COLICIN E3
Molecular weight formula_weight	58043.0 kDa
EC 编号 ec_number	3.1.21.-
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C
Atom count atom_count	8998

MSGGDGRGHNTGAHSTSGNINGGPTGLGVGGGASDGSGWSSENNPWGGGSGSGIHWGGGSGHGNGGGNGNSGGGSGTGGNLSAVAAPVAFGFPALSTPGAGGLAVSISAGALSAAIADIMAALKGPFKFGLWGVALYGVLPSQIAKDDPNMMSKIVTSLPADDITESPVSSLPLDKATVNVNVRVVDDVKDERQNISVVSGVPMSVPVVDAKPTERPGVFTASIPGAPVLNISVNNSTPAVQTLSPGVTNNTDKDVRPAFGTQGGNTRDAVIRFPKDSGHNAVYVSVSDVLSPDQVKQRQDEENRRQQEWDATHPVEAAERNYERARAELNQANEDVARNQERQAKAVQVYNSRKSELDAANKTLADAIAEIKQFNRFAHDPMAGGHRMWQMAGLKAQRAQTDVNNKQAAFDAAAKEKSDADAALSSAMESRKKKEDKKRSAENNLNDEKNKPRKGFKDYGHDYHPAPKTENIKGLGDLKPGIPKTPKQNGGGKRKRWTGDKGRKIYEWDSQHGELEGYRASDGQHLGSFDPKTGNQLKGPDPKRNIKKYL

来源 Source

来源生物 organism	Escherichia coli str. K12 substr.
NCBI Class编号 ncbi_taxonomy_id	316407
宿主生物 host_organism	Escherichia coli str. K12 substr. W3110

Entity 2 Entity 2 polymer

Description description	COLICIN E3 IMMUNITY PROTEIN
Molecular weight formula_weight	9779.6 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D

GLKLDLTWFDKSTEDFKGEEYSKDFGDDGSVMESLGVPFKDNVNNGCFDVIAEWVPLLQPYFNHQIDISDNEYFVSFDYRDGDW

来源 Source

来源生物 organism	Escherichia coli str. K12 substr.
NCBI Class编号 ncbi_taxonomy_id	316407
宿主生物 host_organism	Escherichia coli str. K12 substr. W3110

Entity 3 Entity 3 non-polymer

Description description	CITRIC ACID
Molecular weight formula_weight	192.1 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 4 Entity 4 non-polymer

Description description	GLYCEROL
Molecular weight formula_weight	92.1 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	396

▼

7. Fold Classification (SCOP + CATH) 14 domains

SCOP 2.08 (8 domains)

Domain ID domain_id	d1jcha1
Class class	b — All beta proteins
Fold Fold fold	b.101 — Ribonuclease domain of colicin E3
Superfamily Superfamily superfamily	b.101.1 — Ribonuclease domain of colicin E3
Family Family family	b.101.1.1 — Ribonuclease domain of colicin E3

Domain ID domain_id	d1jcha2
Class class	b — All beta proteins
Fold Fold fold	b.110 — Cloacin translocation domain
Superfamily Superfamily superfamily	b.110.1 — Cloacin translocation domain
Family Family family	b.110.1.1 — Cloacin translocation domain

Domain ID domain_id	d1jcha3
Class class	h — Coiled coil proteins
Fold Fold fold	h.4 — Antiparallel coiled-coil
Superfamily Superfamily superfamily	h.4.9 — Colicin E3 receptor domain
Family Family family	h.4.9.1 — Colicin E3 receptor domain

Domain ID domain_id	d1jchb_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.26 — FKBP-like
Superfamily Superfamily superfamily	d.26.2 — Colicin E3 immunity protein
Family Family family	d.26.2.1 — Colicin E3 immunity protein

Domain ID domain_id	d1jchc1
Class class	b — All beta proteins
Fold Fold fold	b.101 — Ribonuclease domain of colicin E3
Superfamily Superfamily superfamily	b.101.1 — Ribonuclease domain of colicin E3
Family Family family	b.101.1.1 — Ribonuclease domain of colicin E3

Domain ID domain_id	d1jchc2
Class class	b — All beta proteins
Fold Fold fold	b.110 — Cloacin translocation domain
Superfamily Superfamily superfamily	b.110.1 — Cloacin translocation domain
Family Family family	b.110.1.1 — Cloacin translocation domain

Domain ID domain_id	d1jchc3
Class class	h — Coiled coil proteins
Fold Fold fold	h.4 — Antiparallel coiled-coil
Superfamily Superfamily superfamily	h.4.9 — Colicin E3 receptor domain
Family Family family	h.4.9.1 — Colicin E3 receptor domain

Domain ID domain_id	d1jchd_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.26 — FKBP-like
Superfamily Superfamily superfamily	d.26.2 — Colicin E3 immunity protein
Family Family family	d.26.2.1 — Colicin E3 immunity protein

CATH v4.4 (6 domains)

Domain ID domain_id	1jchA02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	620 — Helix Hairpins

Domain ID domain_id	1jchA03
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	380 — Ribonuclease domain of colicin e3 (Residues 456-551)
Homologous superfamily homologous superfamily	10 — Colicin E3-like ribonuclease domain

Domain ID domain_id	1jchB00
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	50 — Chitinase A; domain 3
Homologous superfamily homologous superfamily	20 — Cloacin immunity protein

Domain ID domain_id	1jchC02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	620 — Helix Hairpins

Domain ID domain_id	1jchC03
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	380 — Ribonuclease domain of colicin e3 (Residues 456-551)
Homologous superfamily homologous superfamily	10 — Colicin E3-like ribonuclease domain

Domain ID domain_id	1jchD00
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	50 — Chitinase A; domain 3
Homologous superfamily homologous superfamily	20 — Cloacin immunity protein

▶

8. Citations (1)

▶

Unit-cell length a length_a	66.986 Å
Unit-cell length b length_b	195.733 Å
Unit-cell length c length_c	85.124 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	113.22 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	3.020 Å
Low-resolution limit resolution_low	20.170 Å
R factor r_factor	0.2370
R_work r_work	0.2370
R_free r_free	0.2830

fit	/app/data/saxs_computation/jc/1jch/1jch.fit
pddf	/app/data/pr_computation/jc/1jch/1jch.pr.out
profile	/app/data/saxs_computation/jc/1jch/1jch.dat

Crystal Structure of Colicin E3 in Complex with its Immunity Protein

1. Protein Identity and Related Structures Protein Identity & Related Structures

COLICIN E3

State in the Current Structure

Other States of the Same Protein in the Database

COLICIN E3 IMMUNITY PROTEIN

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Fold Classification (SCOP + CATH) 14 domains

SCOP 2.08 (8 domains)

CATH v4.4 (6 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)