SAXSdb — 1jm1

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Rieske iron-sulfur protein soxF

Sulfolobus acidocaldarius

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein monomer	Monomer	Protein 1	MAGNESIUM ION × 1 FE2/S2 (INORGANIC) CLUSTER × 1 water × 1	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q53766_SULAC
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–204； UniProt 47–250

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1jm1
Deposition date deposition_date	2001-07-17
Structure title title	Crystal structure of the soluble domain of the Rieske protein II (soxF) from Sulfolobus acidocaldarius
Keywords keywords	Rieske iron-sulfur protein, electron transport, respiratory chain, oxidoreductase; electron transport, oxidoreductase
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1jm1__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1jm1__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1jm1__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	16.86 Å
Rg (electron density)	15.46 Å
Total Rg	16.58 Å
Atom count	2979
Residues	202
Excluded volume	27047 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1jm1__assembly_1__model_1`	monomeric （1）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Rieske iron-sulfur protein soxF
Molecular weight formula_weight	21699.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	3460

ADNTDGLAGFPRYKVANIQQVQQQIKSSGCAVYFFAYPLTDEPCFLVDLQALTGQQITEIPNPYYGKYAGPLGQIQTIKGVGPNGTIFAFSDVCVHLGCQLPAQVIVSSESDPGLYAKGADLHCPCHGSIYALKDGGVVVSGPAPRPLPIVILDYDSSTGDIYAVGTNAPYFSAGIPRTTPQDNLLYDPRYSYSVPNNPSCSNG

Source Source

Source organism organism	Sulfolobus acidocaldarius
NCBI taxonomy ID ncbi_taxonomy_id	2285
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 3 Entity 3 non-polymer

Description description	FE2/S2 (INORGANIC) CLUSTER
Molecular weight formula_weight	175.8 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	285

▼

6. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (1 domains)

Domain ID domain_id	d1jm1a_
Class class	b — All beta proteins
Fold Fold fold	b.33 — ISP domain
Superfamily Superfamily superfamily	b.33.1 — ISP domain
Family Family family	b.33.1.1 — Rieske iron-sulfur protein (ISP)

CATH v4.4 (1 domains)

Domain ID domain_id	1jm1A00
Class class	2 — Mainly Beta
Architecture architecture	102 — 3-layer Sandwich
Topology topology	10 — Rieske Iron-sulfur Protein
Homologous superfamily homologous superfamily	10 — Rieske [2Fe-2S] iron-sulphur domain

▶

Unit-cell length a length_a	80.252 Å
Unit-cell length b length_b	80.252 Å
Unit-cell length c length_c	75.624 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	6

Space group space_group	P 61
Space-group number int_tables_number	169
Crystal system crystal_system	—

Resolution resolution	1.110 Å
Low-resolution limit resolution_low	20.000 Å
R factor r_factor	0.1063
R_work r_work	0.1063
R_free r_free	0.1247

Crystal structure of the soluble domain of the Rieske protein II (soxF) from Sulfolobus acidocaldarius

1. Protein Identity and Related Structures Protein Identity & Related Structures

Rieske iron-sulfur protein soxF

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1jm1__assembly_1__model_1

1jm1__assembly_1__model_1 | I(q)

1jm1__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (1 domains)

CATH v4.4 (1 domains)

7. Citations (3)

Crystal structure of the soluble domain of the Rieske protein II (soxF) from Sulfolobus acidocaldarius

1. Protein Identity and Related Structures Protein Identity & Related Structures

Rieske iron-sulfur protein soxF

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1jm1__assembly_1__model_1

1jm1__assembly_1__model_1 | I(q)

1jm1__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (1 domains)

CATH v4.4 (1 domains)

7. Citations (3)