SAXSdb — 1js2

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

high-potential iron protein

Allochromatium vinosum

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 4	IRON/SULFUR CLUSTER × 4 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	HIP_CHRVI
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 5–89； UniProt 38–122 Author chain B； PDBConstruct 5–89； UniProt 38–122 Author chain C； PDBConstruct 5–89； UniProt 38–122 Author chain D； PDBConstruct 5–89； UniProt 38–122

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1js2
Deposition date deposition_date	2001-08-16
Structure title title	Crystal structure of C77S HiPIP: a serine ligated [4Fe-4S] cluster
Keywords keywords	serine ligated [4Fe-4S] cluster, ELECTRON TRANSPORT; ELECTRON TRANSPORT
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1js2__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1js2__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1js2__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	25.68 Å
Rg (electron density)	25.46 Å
Total Rg	25.91 Å
Atom count	2672
Residues	356
Excluded volume	47156 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1js2__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	high-potential iron protein
Molecular weight formula_weight	9435.5 kDa
Mutation mutation	C77S
Source method src_method	man
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	2860

MEFMSAPANAVAADDATAIALKYNQDATKSERVAAARPGLPPEEQHCANCQFMQADAAGATDEWKGCQLFPGKLINVNGWSASWTLKAG

Source Source

Source organism organism	Allochromatium vinosum
NCBI taxonomy ID ncbi_taxonomy_id	1049
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	IRON/SULFUR CLUSTER
Molecular weight formula_weight	351.6 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	188

▼

6. Fold Classification (SCOP + CATH) 12 domains

SCOP 2.08 (8 domains)

Domain ID domain_id	d1js2a1
Class class	g — Small proteins
Fold Fold fold	g.35 — HIPIP (high potential iron protein)
Superfamily Superfamily superfamily	g.35.1 — HIPIP (high potential iron protein)
Family Family family	g.35.1.1 — HIPIP (high potential iron protein)

Domain ID domain_id	d1js2a2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d1js2b1
Class class	g — Small proteins
Fold Fold fold	g.35 — HIPIP (high potential iron protein)
Superfamily Superfamily superfamily	g.35.1 — HIPIP (high potential iron protein)
Family Family family	g.35.1.1 — HIPIP (high potential iron protein)

Domain ID domain_id	d1js2b2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d1js2c1
Class class	g — Small proteins
Fold Fold fold	g.35 — HIPIP (high potential iron protein)
Superfamily Superfamily superfamily	g.35.1 — HIPIP (high potential iron protein)
Family Family family	g.35.1.1 — HIPIP (high potential iron protein)

Domain ID domain_id	d1js2c2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d1js2d1
Class class	g — Small proteins
Fold Fold fold	g.35 — HIPIP (high potential iron protein)
Superfamily Superfamily superfamily	g.35.1 — HIPIP (high potential iron protein)
Family Family family	g.35.1.1 — HIPIP (high potential iron protein)

Domain ID domain_id	d1js2d2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

CATH v4.4 (4 domains)

Domain ID domain_id	1js2A00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	490 — High-Potential Iron-Sulfur Protein; Chain A
Homologous superfamily homologous superfamily	10 — High potential iron-sulphur protein

Domain ID domain_id	1js2B00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	490 — High-Potential Iron-Sulfur Protein; Chain A
Homologous superfamily homologous superfamily	10 — High potential iron-sulphur protein

Domain ID domain_id	1js2C00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	490 — High-Potential Iron-Sulfur Protein; Chain A
Homologous superfamily homologous superfamily	10 — High potential iron-sulphur protein

Domain ID domain_id	1js2D00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	490 — High-Potential Iron-Sulfur Protein; Chain A
Homologous superfamily homologous superfamily	10 — High potential iron-sulphur protein

▶

Unit-cell length a length_a	67.059 Å
Unit-cell length b length_b	30.182 Å
Unit-cell length c length_c	68.738 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	111.27 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	1.900 Å
Low-resolution limit resolution_low	15.000 Å
R factor r_factor	—
R_work r_work	0.1930
R_free r_free	0.2340

Crystal structure of C77S HiPIP: a serine ligated [4Fe-4S] cluster

1. Protein Identity and Related Structures Protein Identity & Related Structures

high-potential iron protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1js2__assembly_1__model_1

1js2__assembly_1__model_1 | I(q)

1js2__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 12 domains

SCOP 2.08 (8 domains)

CATH v4.4 (4 domains)

7. Citations (1)

Crystal structure of C77S HiPIP: a serine ligated [4Fe-4S] cluster

1. Protein Identity and Related Structures Protein Identity & Related Structures

high-potential iron protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1js2__assembly_1__model_1

1js2__assembly_1__model_1 | I(q)

1js2__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 12 domains

SCOP 2.08 (8 domains)

CATH v4.4 (4 domains)

7. Citations (1)