1occ

STRUCTURE OF BOVINE HEART CYTOCHROME C OXIDASE AT THE FULLY OXIDIZED STATE

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

CYTOCHROME C OXIDASE

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 26	CYTOCHROME C OXIDASE × 2 （P68530） CYTOCHROME C OXIDASE × 2 （P00415） CYTOCHROME C OXIDASE × 2 （P00423） CYTOCHROME C OXIDASE × 2 （P00426） CYTOCHROME C OXIDASE × 2 （P00428） CYTOCHROME C OXIDASE × 2 （P07471） CYTOCHROME C OXIDASE × 2 （P00429） CYTOCHROME C OXIDASE × 2 （P04038） CYTOCHROME C OXIDASE × 2 （P07470） CYTOCHROME C OXIDASE × 2 （P13183） CYTOCHROME C OXIDASE × 2 （P00430） CYTOCHROME C OXIDASE × 2 （P10175） COPPER (II) ION × 6 MAGNESIUM ION × 2 HEME-A × 4 ZINC ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX1_BOVIN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–514； UniProt 1–514 Author chain N； PDBConstruct 1–514； UniProt 1–514

CYTOCHROME C OXIDASE

OrganismNot specified

UniProt P68530

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 26	CYTOCHROME C OXIDASE × 2 （P00396） CYTOCHROME C OXIDASE × 2 （P00415） CYTOCHROME C OXIDASE × 2 （P00423） CYTOCHROME C OXIDASE × 2 （P00426） CYTOCHROME C OXIDASE × 2 （P00428） CYTOCHROME C OXIDASE × 2 （P07471） CYTOCHROME C OXIDASE × 2 （P00429） CYTOCHROME C OXIDASE × 2 （P04038） CYTOCHROME C OXIDASE × 2 （P07470） CYTOCHROME C OXIDASE × 2 （P13183） CYTOCHROME C OXIDASE × 2 （P00430） CYTOCHROME C OXIDASE × 2 （P10175） COPPER (II) ION × 6 MAGNESIUM ION × 2 HEME-A × 4 ZINC ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX2_BOVIN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–227； UniProt 1–227 Author chain O； PDBConstruct 1–227； UniProt 1–227

CYTOCHROME C OXIDASE

OrganismNot specified

UniProt P00415

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 26	CYTOCHROME C OXIDASE × 2 （P00396） CYTOCHROME C OXIDASE × 2 （P68530） CYTOCHROME C OXIDASE × 2 （P00423） CYTOCHROME C OXIDASE × 2 （P00426） CYTOCHROME C OXIDASE × 2 （P00428） CYTOCHROME C OXIDASE × 2 （P07471） CYTOCHROME C OXIDASE × 2 （P00429） CYTOCHROME C OXIDASE × 2 （P04038） CYTOCHROME C OXIDASE × 2 （P07470） CYTOCHROME C OXIDASE × 2 （P13183） CYTOCHROME C OXIDASE × 2 （P00430） CYTOCHROME C OXIDASE × 2 （P10175） COPPER (II) ION × 6 MAGNESIUM ION × 2 HEME-A × 4 ZINC ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX3_BOVIN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–261； UniProt 1–261 Author chain P； PDBConstruct 1–261； UniProt 1–261

CYTOCHROME C OXIDASE

OrganismNot specified

UniProt P00423

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 26	CYTOCHROME C OXIDASE × 2 （P00396） CYTOCHROME C OXIDASE × 2 （P68530） CYTOCHROME C OXIDASE × 2 （P00415） CYTOCHROME C OXIDASE × 2 （P00426） CYTOCHROME C OXIDASE × 2 （P00428） CYTOCHROME C OXIDASE × 2 （P07471） CYTOCHROME C OXIDASE × 2 （P00429） CYTOCHROME C OXIDASE × 2 （P04038） CYTOCHROME C OXIDASE × 2 （P07470） CYTOCHROME C OXIDASE × 2 （P13183） CYTOCHROME C OXIDASE × 2 （P00430） CYTOCHROME C OXIDASE × 2 （P10175） COPPER (II) ION × 6 MAGNESIUM ION × 2 HEME-A × 4 ZINC ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX41_BOVIN
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–147； UniProt 23–169 Author chain Q； PDBConstruct 1–147； UniProt 23–169

CYTOCHROME C OXIDASE

OrganismNot specified

UniProt P00426

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 26	CYTOCHROME C OXIDASE × 2 （P00396） CYTOCHROME C OXIDASE × 2 （P68530） CYTOCHROME C OXIDASE × 2 （P00415） CYTOCHROME C OXIDASE × 2 （P00423） CYTOCHROME C OXIDASE × 2 （P00428） CYTOCHROME C OXIDASE × 2 （P07471） CYTOCHROME C OXIDASE × 2 （P00429） CYTOCHROME C OXIDASE × 2 （P04038） CYTOCHROME C OXIDASE × 2 （P07470） CYTOCHROME C OXIDASE × 2 （P13183） CYTOCHROME C OXIDASE × 2 （P00430） CYTOCHROME C OXIDASE × 2 （P10175） COPPER (II) ION × 6 MAGNESIUM ION × 2 HEME-A × 4 ZINC ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX5A_BOVIN
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–109； UniProt 1–109 Author chain R； PDBConstruct 1–109； UniProt 1–109

CYTOCHROME C OXIDASE

OrganismNot specified

UniProt P00428

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 26	CYTOCHROME C OXIDASE × 2 （P00396） CYTOCHROME C OXIDASE × 2 （P68530） CYTOCHROME C OXIDASE × 2 （P00415） CYTOCHROME C OXIDASE × 2 （P00423） CYTOCHROME C OXIDASE × 2 （P00426） CYTOCHROME C OXIDASE × 2 （P07471） CYTOCHROME C OXIDASE × 2 （P00429） CYTOCHROME C OXIDASE × 2 （P04038） CYTOCHROME C OXIDASE × 2 （P07470） CYTOCHROME C OXIDASE × 2 （P13183） CYTOCHROME C OXIDASE × 2 （P00430） CYTOCHROME C OXIDASE × 2 （P10175） COPPER (II) ION × 6 MAGNESIUM ION × 2 HEME-A × 4 ZINC ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX5B_BOVIN
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–98； UniProt 1–98 Author chain S； PDBConstruct 1–98； UniProt 1–98

CYTOCHROME C OXIDASE

OrganismNot specified

UniProt P07471

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 26	CYTOCHROME C OXIDASE × 2 （P00396） CYTOCHROME C OXIDASE × 2 （P68530） CYTOCHROME C OXIDASE × 2 （P00415） CYTOCHROME C OXIDASE × 2 （P00423） CYTOCHROME C OXIDASE × 2 （P00426） CYTOCHROME C OXIDASE × 2 （P00428） CYTOCHROME C OXIDASE × 2 （P00429） CYTOCHROME C OXIDASE × 2 （P04038） CYTOCHROME C OXIDASE × 2 （P07470） CYTOCHROME C OXIDASE × 2 （P13183） CYTOCHROME C OXIDASE × 2 （P00430） CYTOCHROME C OXIDASE × 2 （P10175） COPPER (II) ION × 6 MAGNESIUM ION × 2 HEME-A × 4 ZINC ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CX6A2_BOVIN
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–84； UniProt 13–96 Author chain T； PDBConstruct 1–84； UniProt 13–96

CYTOCHROME C OXIDASE

OrganismNot specified

UniProt P00429

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 26	CYTOCHROME C OXIDASE × 2 （P00396） CYTOCHROME C OXIDASE × 2 （P68530） CYTOCHROME C OXIDASE × 2 （P00415） CYTOCHROME C OXIDASE × 2 （P00423） CYTOCHROME C OXIDASE × 2 （P00426） CYTOCHROME C OXIDASE × 2 （P00428） CYTOCHROME C OXIDASE × 2 （P07471） CYTOCHROME C OXIDASE × 2 （P04038） CYTOCHROME C OXIDASE × 2 （P07470） CYTOCHROME C OXIDASE × 2 （P13183） CYTOCHROME C OXIDASE × 2 （P00430） CYTOCHROME C OXIDASE × 2 （P10175） COPPER (II) ION × 6 MAGNESIUM ION × 2 HEME-A × 4 ZINC ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX6B_BOVIN
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–85； UniProt 1–85 Author chain U； PDBConstruct 1–85； UniProt 1–85

CYTOCHROME C OXIDASE

OrganismNot specified

UniProt P04038

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 26	CYTOCHROME C OXIDASE × 2 （P00396） CYTOCHROME C OXIDASE × 2 （P68530） CYTOCHROME C OXIDASE × 2 （P00415） CYTOCHROME C OXIDASE × 2 （P00423） CYTOCHROME C OXIDASE × 2 （P00426） CYTOCHROME C OXIDASE × 2 （P00428） CYTOCHROME C OXIDASE × 2 （P07471） CYTOCHROME C OXIDASE × 2 （P00429） CYTOCHROME C OXIDASE × 2 （P07470） CYTOCHROME C OXIDASE × 2 （P13183） CYTOCHROME C OXIDASE × 2 （P00430） CYTOCHROME C OXIDASE × 2 （P10175） COPPER (II) ION × 6 MAGNESIUM ION × 2 HEME-A × 4 ZINC ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX6C_BOVIN
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain I； PDBConstruct 1–73； UniProt 1–73 Author chain V； PDBConstruct 1–73； UniProt 1–73

CYTOCHROME C OXIDASE

OrganismNot specified

UniProt P07470

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 26	CYTOCHROME C OXIDASE × 2 （P00396） CYTOCHROME C OXIDASE × 2 （P68530） CYTOCHROME C OXIDASE × 2 （P00415） CYTOCHROME C OXIDASE × 2 （P00423） CYTOCHROME C OXIDASE × 2 （P00426） CYTOCHROME C OXIDASE × 2 （P00428） CYTOCHROME C OXIDASE × 2 （P07471） CYTOCHROME C OXIDASE × 2 （P00429） CYTOCHROME C OXIDASE × 2 （P04038） CYTOCHROME C OXIDASE × 2 （P13183） CYTOCHROME C OXIDASE × 2 （P00430） CYTOCHROME C OXIDASE × 2 （P10175） COPPER (II) ION × 6 MAGNESIUM ION × 2 HEME-A × 4 ZINC ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CX7A1_BOVIN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain J； PDBConstruct 1–59； UniProt 22–80 Author chain W； PDBConstruct 1–59； UniProt 22–80

CYTOCHROME C OXIDASE

OrganismNot specified

UniProt P13183

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 26	CYTOCHROME C OXIDASE × 2 （P00396） CYTOCHROME C OXIDASE × 2 （P68530） CYTOCHROME C OXIDASE × 2 （P00415） CYTOCHROME C OXIDASE × 2 （P00423） CYTOCHROME C OXIDASE × 2 （P00426） CYTOCHROME C OXIDASE × 2 （P00428） CYTOCHROME C OXIDASE × 2 （P07471） CYTOCHROME C OXIDASE × 2 （P00429） CYTOCHROME C OXIDASE × 2 （P04038） CYTOCHROME C OXIDASE × 2 （P07470） CYTOCHROME C OXIDASE × 2 （P00430） CYTOCHROME C OXIDASE × 2 （P10175） COPPER (II) ION × 6 MAGNESIUM ION × 2 HEME-A × 4 ZINC ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX7B_BOVIN
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain K； PDBConstruct 1–56； UniProt 33–88 Author chain X； PDBConstruct 1–56； UniProt 33–88

CYTOCHROME C OXIDASE

OrganismNot specified

UniProt P00430

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 26	CYTOCHROME C OXIDASE × 2 （P00396） CYTOCHROME C OXIDASE × 2 （P68530） CYTOCHROME C OXIDASE × 2 （P00415） CYTOCHROME C OXIDASE × 2 （P00423） CYTOCHROME C OXIDASE × 2 （P00426） CYTOCHROME C OXIDASE × 2 （P00428） CYTOCHROME C OXIDASE × 2 （P07471） CYTOCHROME C OXIDASE × 2 （P00429） CYTOCHROME C OXIDASE × 2 （P04038） CYTOCHROME C OXIDASE × 2 （P07470） CYTOCHROME C OXIDASE × 2 （P13183） CYTOCHROME C OXIDASE × 2 （P10175） COPPER (II) ION × 6 MAGNESIUM ION × 2 HEME-A × 4 ZINC ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX7C_BOVIN
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain L； PDBConstruct 1–47； UniProt 17–63 Author chain Y； PDBConstruct 1–47； UniProt 17–63

CYTOCHROME C OXIDASE

OrganismNot specified

UniProt P10175

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 26	CYTOCHROME C OXIDASE × 2 （P00396） CYTOCHROME C OXIDASE × 2 （P68530） CYTOCHROME C OXIDASE × 2 （P00415） CYTOCHROME C OXIDASE × 2 （P00423） CYTOCHROME C OXIDASE × 2 （P00426） CYTOCHROME C OXIDASE × 2 （P00428） CYTOCHROME C OXIDASE × 2 （P07471） CYTOCHROME C OXIDASE × 2 （P00429） CYTOCHROME C OXIDASE × 2 （P04038） CYTOCHROME C OXIDASE × 2 （P07470） CYTOCHROME C OXIDASE × 2 （P13183） CYTOCHROME C OXIDASE × 2 （P00430） COPPER (II) ION × 6 MAGNESIUM ION × 2 HEME-A × 4 ZINC ION × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COX81_BOVIN
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain M； PDBConstruct 1–46； UniProt 25–70 Author chain Z； PDBConstruct 1–46； UniProt 25–70

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1occ
Deposition date deposition_date	1996-04-18
Structure title title	STRUCTURE OF BOVINE HEART CYTOCHROME C OXIDASE AT THE FULLY OXIDIZED STATE
Keywords keywords	CYTOCHROME C OXIDASE, OXIDOREDUCTASE (CYTOCHROME(C)-OXYGEN); OXIDOREDUCTASE (CYTOCHROME(C)-OXYGEN)
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1occ__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1occ__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1occ__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	50.98 Å
Rg (electron density)	50.52 Å
Total Rg	50.82 Å
Atom count	28722
Residues	3560
Excluded volume	517740 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1occ__assembly_1__model_1`	26-meric （26）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (17)

Entity 1 Entity 1 polymer

Description description	CYTOCHROME C OXIDASE
Molecular weight formula_weight	57065.8 kDa
EC 编号 ec_number	1.9.3.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,N
Atom count atom_count	28722

MFINRWLFSTNHKDIGTLYLLFGAWAGMVGTALSLLIRAELGQPGTLLGDDQIYNVVVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMSQYQTPLFVWSVMITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGGNIKWSPAMMWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPLFSGYTLNDTWAKIHFAIMFVGVNMTFFPQHFLGLSGMPRRYSDYPDAYTMWNTISSMGSFISLTAVMLMVFIIWEAFASKREVLTVDLTTTNLEWLNGCPPPYHTFEEPTYVNLK

Entity 2 Entity 2 polymer

Description description	CYTOCHROME C OXIDASE
Molecular weight formula_weight	26040.4 kDa
EC 编号 ec_number	1.9.3.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,O

MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML

Entity 3 Entity 3 polymer

Description description	CYTOCHROME C OXIDASE
Molecular weight formula_weight	29943.6 kDa
EC 编号 ec_number	1.9.3.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,P

MTHQTHAYHMVNPSPWPLTGALSALLMTSGLTMWFHFNSMTLLMIGLTTNMLTMYQWWRDVIRESTFQGHHTPAVQKGLRYGMILFIISEVLFFTGFFWAFYHSSLAPTPELGGCWPPTGIHPLNPLEVPLLNTSVLLASGVSITWAHHSLMEGDRKHMLQALFITITLGVYFTLLQASEYYEAPFTISDGVYGSTFFVATGFHGLHVIIGSTFLIVCFFRQLKFHFTSNHHFGFEAGAWYWHFVDVVWLFLYVSIYWWGS

Entity 4 Entity 4 polymer

Description description	CYTOCHROME C OXIDASE
Molecular weight formula_weight	17179.6 kDa
EC 编号 ec_number	1.9.3.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,Q

AHGSVVKSEDYALPSYVDRRDYPLPDVAHVKNLSASQKALKEKEKASWSSLSIDEKVELYRLKFKESFAEMNRSTNEWKTVVGAAMFFIGFTALLLIWEKHYVYGPIPHTFEEEWVAKQTKRMLDMKVAPIQGFSAKWDYDKNEWKK

Entity 5 Entity 5 polymer

Description description	CYTOCHROME C OXIDASE
Molecular weight formula_weight	12453.1 kDa
EC 编号 ec_number	1.9.3.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,R

SHGSHETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV

Entity 6 Entity 6 polymer

Description description	CYTOCHROME C OXIDASE
Molecular weight formula_weight	10684.0 kDa
EC 编号 ec_number	1.9.3.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,S

ASGGGVPTDEEQATGLEREVMLAARKGQDPYNILAPKATSGTKEDPNLVPSITNKRIVGCICEEDNSTVIWFWLHKGEAQRCPSCGTHYKLVPHQLAH

Entity 7 Entity 7 polymer

Description description	CYTOCHROME C OXIDASE
Molecular weight formula_weight	9452.7 kDa
EC 编号 ec_number	1.9.3.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,T

ASAAKGDHGGTGARTWRFLTFGLALPSVALCTLNSWLHSGHRERPAFIPYHHLRIRTKPFSWGDGNHTFFHNPRVNPLPTGYEK

Entity 8 Entity 8 polymer

Description description	CYTOCHROME C OXIDASE
Molecular weight formula_weight	10039.2 kDa
EC 编号 ec_number	1.9.3.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,U

AEDIQAKIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI

Entity 9 Entity 9 polymer

Description description	CYTOCHROME C OXIDASE
Molecular weight formula_weight	8495.0 kDa
EC 编号 ec_number	1.9.3.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I,V

STALAKPQMRGLLARRLRFHIVGAFMVSLGFATFYKFAVAEKRKKAYADFYRNYDSMKDFEEMRKAGIFQSAK

Entity 10 Entity 10 polymer

Description description	CYTOCHROME C OXIDASE
Molecular weight formula_weight	6682.7 kDa
EC 编号 ec_number	1.9.3.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J,W

FENRVAEKQKLFQEDNGLPVHLKGGATDNILYRVTMTLCLGGTLYSLYCLGWASFPHKK

Entity 11 Entity 11 polymer

Description description	CYTOCHROME C OXIDASE
Molecular weight formula_weight	6365.2 kDa
EC 编号 ec_number	1.9.3.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K,X

IHQKRAPDFHDKYGNAVLASGATFCVAVWVYMATQIGIEWNPSPVGRVTPKEWREQ

Entity 12 Entity 12 polymer

Description description	CYTOCHROME C OXIDASE
Molecular weight formula_weight	5449.4 kDa
EC 编号 ec_number	1.9.3.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L,Y

SHYEEGPGKNIPFSVENKWRLLAMMTLFFGSGFAAPFFIVRHQLLKK

Entity 13 Entity 13 polymer

Description description	CYTOCHROME C OXIDASE
Molecular weight formula_weight	4967.8 kDa
EC 编号 ec_number	1.9.3.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M,Z

ITAKPAKTPTSPKEQAIGLSVTFLSFLLPAGWVLYHLDNYKKSSAA

Entity 14 Entity 14 non-polymer

Description description	COPPER (II) ION
Molecular weight formula_weight	63.5 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 15 Entity 15 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 16 Entity 16 non-polymer

Description description	HEME-A
Molecular weight formula_weight	852.8 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 17 Entity 17 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	2

▼

6. Fold Classification (SCOP + CATH) 58 domains

SCOP 2.08 (28 domains)

Domain ID domain_id	d1occa_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.24 — Cytochrome c oxidase subunit I-like
Superfamily Superfamily superfamily	f.24.1 — Cytochrome c oxidase subunit I-like
Family Family family	f.24.1.1 — Cytochrome c oxidase subunit I-like

Domain ID domain_id	d1occb1
Class class	b — All beta proteins
Fold Fold fold	b.6 — Cupredoxin-like
Superfamily Superfamily superfamily	b.6.1 — Cupredoxins
Family Family family	b.6.1.2 — Periplasmic domain of cytochrome c oxidase subunit II

Domain ID domain_id	d1occb2
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.17 — Transmembrane helix hairpin
Superfamily Superfamily superfamily	f.17.2 — Cytochrome c oxidase subunit II-like, transmembrane region
Family Family family	f.17.2.1 — Cytochrome c oxidase subunit II-like, transmembrane region

Domain ID domain_id	d1occc_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.25 — Cytochrome c oxidase subunit III-like
Superfamily Superfamily superfamily	f.25.1 — Cytochrome c oxidase subunit III-like
Family Family family	f.25.1.1 — Cytochrome c oxidase subunit III-like

Domain ID domain_id	d1occd_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.1 — Mitochondrial cytochrome c oxidase subunit IV
Family Family family	f.23.1.1 — Mitochondrial cytochrome c oxidase subunit IV

Domain ID domain_id	d1occe_
Class class	a — All alpha proteins
Fold Fold fold	a.118 — alpha-alpha superhelix
Superfamily Superfamily superfamily	a.118.11 — Cytochrome c oxidase subunit E
Family Family family	a.118.11.1 — Cytochrome c oxidase subunit E

Domain ID domain_id	d1occf_
Class class	g — Small proteins
Fold Fold fold	g.41 — Rubredoxin-like
Superfamily Superfamily superfamily	g.41.5 — Rubredoxin-like
Family Family family	g.41.5.3 — Cytochrome c oxidase Subunit F

Domain ID domain_id	d1occg_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.2 — Mitochondrial cytochrome c oxidase subunit VIa
Family Family family	f.23.2.1 — Mitochondrial cytochrome c oxidase subunit VIa

Domain ID domain_id	d1occh_
Class class	a — All alpha proteins
Fold Fold fold	a.51 — Cytochrome c oxidase subunit h
Superfamily Superfamily superfamily	a.51.1 — Cytochrome c oxidase subunit h
Family Family family	a.51.1.1 — Cytochrome c oxidase subunit h

Domain ID domain_id	d1occi_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.3 — Mitochondrial cytochrome c oxidase subunit VIc
Family Family family	f.23.3.1 — Mitochondrial cytochrome c oxidase subunit VIc

Domain ID domain_id	d1occj_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.4 — Mitochondrial cytochrome c oxidase subunit VIIa
Family Family family	f.23.4.1 — Mitochondrial cytochrome c oxidase subunit VIIa

Domain ID domain_id	d1occk_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.5 — Mitochondrial cytochrome c oxidase subunit VIIb
Family Family family	f.23.5.1 — Mitochondrial cytochrome c oxidase subunit VIIb

Domain ID domain_id	d1occl_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.6 — Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa)
Family Family family	f.23.6.1 — Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa)

Domain ID domain_id	d1occm_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.7 — Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX)
Family Family family	f.23.7.1 — Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX)

Domain ID domain_id	d1occn_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.24 — Cytochrome c oxidase subunit I-like
Superfamily Superfamily superfamily	f.24.1 — Cytochrome c oxidase subunit I-like
Family Family family	f.24.1.1 — Cytochrome c oxidase subunit I-like

Domain ID domain_id	d1occo1
Class class	b — All beta proteins
Fold Fold fold	b.6 — Cupredoxin-like
Superfamily Superfamily superfamily	b.6.1 — Cupredoxins
Family Family family	b.6.1.2 — Periplasmic domain of cytochrome c oxidase subunit II

Domain ID domain_id	d1occo2
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.17 — Transmembrane helix hairpin
Superfamily Superfamily superfamily	f.17.2 — Cytochrome c oxidase subunit II-like, transmembrane region
Family Family family	f.17.2.1 — Cytochrome c oxidase subunit II-like, transmembrane region

Domain ID domain_id	d1occp_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.25 — Cytochrome c oxidase subunit III-like
Superfamily Superfamily superfamily	f.25.1 — Cytochrome c oxidase subunit III-like
Family Family family	f.25.1.1 — Cytochrome c oxidase subunit III-like

Domain ID domain_id	d1occq_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.1 — Mitochondrial cytochrome c oxidase subunit IV
Family Family family	f.23.1.1 — Mitochondrial cytochrome c oxidase subunit IV

Domain ID domain_id	d1occr_
Class class	a — All alpha proteins
Fold Fold fold	a.118 — alpha-alpha superhelix
Superfamily Superfamily superfamily	a.118.11 — Cytochrome c oxidase subunit E
Family Family family	a.118.11.1 — Cytochrome c oxidase subunit E

Domain ID domain_id	d1occs_
Class class	g — Small proteins
Fold Fold fold	g.41 — Rubredoxin-like
Superfamily Superfamily superfamily	g.41.5 — Rubredoxin-like
Family Family family	g.41.5.3 — Cytochrome c oxidase Subunit F

Domain ID domain_id	d1occt_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.2 — Mitochondrial cytochrome c oxidase subunit VIa
Family Family family	f.23.2.1 — Mitochondrial cytochrome c oxidase subunit VIa

Domain ID domain_id	d1occu_
Class class	a — All alpha proteins
Fold Fold fold	a.51 — Cytochrome c oxidase subunit h
Superfamily Superfamily superfamily	a.51.1 — Cytochrome c oxidase subunit h
Family Family family	a.51.1.1 — Cytochrome c oxidase subunit h

Domain ID domain_id	d1occv_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.3 — Mitochondrial cytochrome c oxidase subunit VIc
Family Family family	f.23.3.1 — Mitochondrial cytochrome c oxidase subunit VIc

Domain ID domain_id	d1occw_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.4 — Mitochondrial cytochrome c oxidase subunit VIIa
Family Family family	f.23.4.1 — Mitochondrial cytochrome c oxidase subunit VIIa

Domain ID domain_id	d1occx_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.5 — Mitochondrial cytochrome c oxidase subunit VIIb
Family Family family	f.23.5.1 — Mitochondrial cytochrome c oxidase subunit VIIb

Domain ID domain_id	d1occy_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.6 — Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa)
Family Family family	f.23.6.1 — Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa)

Domain ID domain_id	d1occz_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.7 — Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX)
Family Family family	f.23.7.1 — Mitochondrial cytochrome c oxidase subunit VIIIb (aka IX)

CATH v4.4 (30 domains)

Domain ID domain_id	1occA00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	210 — Cytochrome C Oxidase; Chain A
Homologous superfamily homologous superfamily	10 — Cytochrome c oxidase-like, subunit I domain

Domain ID domain_id	1occB01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	90 —

Domain ID domain_id	1occB02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	420 — Cupredoxins - blue copper proteins

Domain ID domain_id	1occC01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	70 —

Domain ID domain_id	1occC02
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	80 — Cytochrome c oxidase, subunit III, four-helix bundle

Domain ID domain_id	1occD00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	442 — Cytochrome C Oxidase; Chain D
Homologous superfamily homologous superfamily	10 — Cytochrome c oxidase subunit IV

Domain ID domain_id	1occE00
Class class	1 — Mainly Alpha
Architecture architecture	25 — Alpha Horseshoe
Topology topology	40 — Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat
Homologous superfamily homologous superfamily	40 — Cytochrome c oxidase, subunit Va/VI

Domain ID domain_id	1occF00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	11 — Cytochrome C Oxidase; Chain F
Homologous superfamily homologous superfamily	10 — Cytochrome c oxidase, subunit Vb

Domain ID domain_id	1occG00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	95 — Cytochrome C Oxidase; Chain G
Homologous superfamily homologous superfamily	10 — Cytochrome c oxidase, subunit VIa

Domain ID domain_id	1occH00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	140 — Cytochrome c oxidase, subunit VIb

Domain ID domain_id	1occI00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	93 — Cytochrome C Oxidase; Chain I
Homologous superfamily homologous superfamily	10 — Mitochondrial cytochrome c oxidase subunit VIc/VIIs

Domain ID domain_id	1occJ00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	91 — Cytochrome C Oxidase; Chain J
Homologous superfamily homologous superfamily	10 — Cytochrome c oxidase, subunit VIIa

Domain ID domain_id	1occK00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	51 — Cytochrome C Oxidase; Chain K
Homologous superfamily homologous superfamily	10 — Cytochrome C Oxidase, chain K

Domain ID domain_id	1occL00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	49 — Cytochrome C Oxidase; Chain L
Homologous superfamily homologous superfamily	10 — Cytochrome c oxidase subunit VIIc

Domain ID domain_id	1occM00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	81 — Cytochrome C Oxidase; Chain M
Homologous superfamily homologous superfamily	10 — Cytochrome c oxidase, subunit 8

Domain ID domain_id	1occN00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	210 — Cytochrome C Oxidase; Chain A
Homologous superfamily homologous superfamily	10 — Cytochrome c oxidase-like, subunit I domain

Domain ID domain_id	1occO01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	90 —

Domain ID domain_id	1occO02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	420 — Cupredoxins - blue copper proteins

Domain ID domain_id	1occP01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	70 —

Domain ID domain_id	1occP02
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	120 — Four Helix Bundle (Hemerythrin (Met), subunit A)
Homologous superfamily homologous superfamily	80 — Cytochrome c oxidase, subunit III, four-helix bundle

Domain ID domain_id	1occQ00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	442 — Cytochrome C Oxidase; Chain D
Homologous superfamily homologous superfamily	10 — Cytochrome c oxidase subunit IV

Domain ID domain_id	1occR00
Class class	1 — Mainly Alpha
Architecture architecture	25 — Alpha Horseshoe
Topology topology	40 — Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat
Homologous superfamily homologous superfamily	40 — Cytochrome c oxidase, subunit Va/VI

Domain ID domain_id	1occS00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	11 — Cytochrome C Oxidase; Chain F
Homologous superfamily homologous superfamily	10 — Cytochrome c oxidase, subunit Vb

Domain ID domain_id	1occT00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	95 — Cytochrome C Oxidase; Chain G
Homologous superfamily homologous superfamily	10 — Cytochrome c oxidase, subunit VIa

Domain ID domain_id	1occU00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	140 — Cytochrome c oxidase, subunit VIb

Domain ID domain_id	1occV00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	93 — Cytochrome C Oxidase; Chain I
Homologous superfamily homologous superfamily	10 — Mitochondrial cytochrome c oxidase subunit VIc/VIIs

Domain ID domain_id	1occW00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	91 — Cytochrome C Oxidase; Chain J
Homologous superfamily homologous superfamily	10 — Cytochrome c oxidase, subunit VIIa

Domain ID domain_id	1occX00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	51 — Cytochrome C Oxidase; Chain K
Homologous superfamily homologous superfamily	10 — Cytochrome C Oxidase, chain K

Domain ID domain_id	1occY00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	49 — Cytochrome C Oxidase; Chain L
Homologous superfamily homologous superfamily	10 — Cytochrome c oxidase subunit VIIc

Domain ID domain_id	1occZ00
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	81 — Cytochrome C Oxidase; Chain M
Homologous superfamily homologous superfamily	10 — Cytochrome c oxidase, subunit 8

▶

Unit-cell length a length_a	189.100 Å
Unit-cell length b length_b	210.500 Å
Unit-cell length c length_c	178.600 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	2.800 Å
Low-resolution limit resolution_low	10.000 Å
R factor r_factor	0.2010
R_work r_work	0.2010
R_free r_free	0.2520

STRUCTURE OF BOVINE HEART CYTOCHROME C OXIDASE AT THE FULLY OXIDIZED STATE

1. Protein Identity and Related Structures Protein Identity & Related Structures

CYTOCHROME C OXIDASE

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

CYTOCHROME C OXIDASE

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

CYTOCHROME C OXIDASE

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

CYTOCHROME C OXIDASE

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

CYTOCHROME C OXIDASE

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

CYTOCHROME C OXIDASE

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

CYTOCHROME C OXIDASE

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

CYTOCHROME C OXIDASE

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

CYTOCHROME C OXIDASE

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

CYTOCHROME C OXIDASE

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer