SAXSdb — 1ohf

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

p70

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 480	MAGNESIUM ION × 240 water × 240	Review required
2	Protein homooligomer	Homooligomer	Protein 8	MAGNESIUM ION × 4 water × 4	Review required
3	Protein homooligomer	Homooligomer	Protein 40	MAGNESIUM ION × 20 water × 20	Review required
4	Protein homooligomer	Homooligomer	Protein 48	MAGNESIUM ION × 24 water × 24	Review required
5	Protein homooligomer	Homooligomer	Protein 8	MAGNESIUM ION × 4 water × 4	Review required
6	Protein homooligomer	Homooligomer	Protein 480	MAGNESIUM ION × 240 water × 240	Review required

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q4TVS9_9VIRU
Isoform	—
PDB entities	1, 2
Chains and sequence ranges	Author chain A； PDBConstruct 1–570； UniProt 1–570 Author chain B； PDBConstruct 1–570； UniProt 1–570 Author chain C； PDBConstruct 1–570； UniProt 1–570 Author chain D； PDBConstruct 1–570； UniProt 1–570 Author chain E； PDBConstruct 1–74； UniProt 571–644 Author chain F； PDBConstruct 1–74； UniProt 571–644 Author chain G； PDBConstruct 1–74； UniProt 571–644 Author chain H； PDBConstruct 1–74； UniProt 571–644

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1ohf
Deposition date deposition_date	2003-05-26
Structure title title	The refined structure of Nudaurelia capensis omega virus
Keywords keywords	VIRUS, VIRAL COAT, AUTO-CATALYTIC CLEAVAGE, QUASIEQUIVALENCE, NWV, ICOSAHEDRAL VIRUS; VIRUS
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1ohf__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1ohf__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1ohf__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	168.80 Å
Total Rg	168.50 Å
Atom count	1040100
Residues	135780
Excluded volume	18405000 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1ohf__assembly_1__model_1`	240-MERIC （240）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`1ohf__assembly_2__model_1`	tetrameric （4）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
3	1	`1ohf__assembly_3__model_1`	eicosameric （20）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
4	1	`1ohf__assembly_4__model_1`	24-meric （24）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
5	1	`1ohf__assembly_5__model_1`	tetrameric （4）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
6	1	`1ohf__assembly_6__model_1`	240-meric （240）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	p70
Molecular weight formula_weight	62094.8 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D
Atom count atom_count	17851

MDSNSASGKRRSRNVRIAANTVNVAPKQRQARGRRARSRANNIDNVTAAAQELGQSLDANVITFPTNVATMPEFRSWARGKLDIDQDSIGWYFKYLDPAGATESARAVGEYSKIPDGLVKFSVDAEIREIYNEECPTVSDASIPLDGAQWSLSIISYPMFRTAYFAVANVDNKEISLDVTNDLIVWLNNLASWRDVVDSGQWFTFSDDPTWFVRIRVLHPTYDLPDPTEGLLRTVSDYRLTYKSITCEANMPTLVDQGFWIGGHYALTPIATTQNAVEGSGFVHPFNVTRPGIAAGVTLTWASMPPGGSAPSGDPAWIPDSTTQFQWRHGGFDAPTGVITYTIPRGYTMQYFDTTTNEWNGFANPDDVVTFGQTGGAAGTNATITITAPTVTLTILATTTSAANVINFRNLDAETTAASNRSEVPLPPLTFGQTAPNNPKIEQTLVKDTLGSYLVHSKMRNPVFQLTPASSFGAISFTNPGFDRNLDLPGFGGIRDSLDVNMSTAVCHFRSLSKSCSIVTKTYQGWEGVTNVNTPFGQFAHSGLLKNDEILCLADDLATRLTGVYGATDN

Entity 2 Entity 2 polymer

Description description	p70
Molecular weight formula_weight	7815.1 kDa
Source method src_method	nat
Copy count entity_count	4

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,F,G,H

FAAAVLAFAANMLTSVLKSEATTSVIKELGNQATGLANQGLARLPGLLASIPGKIAARVRARRDRRRAARMNNN

Entity 3 Entity 3 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	516

▼

6. Fold Classification (SCOP + CATH) 12 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d1ohfa_
Class class	b — All beta proteins
Fold Fold fold	b.121 — Nucleoplasmin-like/VP (viral coat and capsid proteins)
Superfamily Superfamily superfamily	b.121.4 — Positive stranded ssRNA viruses
Family Family family	b.121.4.8 — Tetraviridae-like VP

Domain ID domain_id	d1ohfb_
Class class	b — All beta proteins
Fold Fold fold	b.121 — Nucleoplasmin-like/VP (viral coat and capsid proteins)
Superfamily Superfamily superfamily	b.121.4 — Positive stranded ssRNA viruses
Family Family family	b.121.4.8 — Tetraviridae-like VP

Domain ID domain_id	d1ohfc_
Class class	b — All beta proteins
Fold Fold fold	b.121 — Nucleoplasmin-like/VP (viral coat and capsid proteins)
Superfamily Superfamily superfamily	b.121.4 — Positive stranded ssRNA viruses
Family Family family	b.121.4.8 — Tetraviridae-like VP

Domain ID domain_id	d1ohfd_
Class class	b — All beta proteins
Fold Fold fold	b.121 — Nucleoplasmin-like/VP (viral coat and capsid proteins)
Superfamily Superfamily superfamily	b.121.4 — Positive stranded ssRNA viruses
Family Family family	b.121.4.8 — Tetraviridae-like VP

CATH v4.4 (8 domains)

Domain ID domain_id	1ohfA02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	1ohfA03
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	270 — Mutm (Fpg) Protein; Chain: A, domain 2
Homologous superfamily homologous superfamily	70 —

Domain ID domain_id	1ohfB02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	1ohfB03
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	270 — Mutm (Fpg) Protein; Chain: A, domain 2
Homologous superfamily homologous superfamily	70 —

Domain ID domain_id	1ohfC02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	1ohfC03
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	270 — Mutm (Fpg) Protein; Chain: A, domain 2
Homologous superfamily homologous superfamily	70 —

Domain ID domain_id	1ohfD02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	1ohfD03
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	270 — Mutm (Fpg) Protein; Chain: A, domain 2
Homologous superfamily homologous superfamily	70 —

▶

Unit-cell length a length_a	413.550 Å
Unit-cell length b length_b	410.220 Å
Unit-cell length c length_c	419.670 Å
Unit-cell angle α angle_alpha	59.13 °
Unit-cell angle β angle_beta	58.90 °
Unit-cell angle γ angle_gamma	64.04 °
Molecules per unit cell Z z_pdb	240

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.800 Å
Low-resolution limit resolution_low	20.000 Å
R factor r_factor	0.2190
R_work r_work	0.2190
R_free r_free	0.2210

The refined structure of Nudaurelia capensis omega virus

1. Protein Identity and Related Structures Protein Identity & Related Structures

p70

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1ohf__assembly_1__model_1

1ohf__assembly_1__model_1 | I(q)

1ohf__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 12 domains

SCOP 2.08 (4 domains)

CATH v4.4 (8 domains)

7. Citations (3)

The refined structure of Nudaurelia capensis omega virus

1. Protein Identity and Related Structures Protein Identity & Related Structures

p70

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1ohf__assembly_1__model_1

1ohf__assembly_1__model_1 | I(q)

1ohf__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 12 domains

SCOP 2.08 (4 domains)

CATH v4.4 (8 domains)

7. Citations (3)