SAXSdb — 1osg

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tumor necrosis factor ligand superfamily member 13B

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 6 PDB declaration: hexameric（6） Consistent with protein copy count	Chain A； UniProt 82–285 Chain B； UniProt 82–285 Chain C； UniProt 82–285	Fragment：TNF domain	BR3 derived PEPTIDE × 3 MG MAGNESIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.7；292 K；20% PEG 3350, 1.0 M LiCl, 0.1M sodium cacodylate, pH 6.7, VAPOR DIFFUSION, HANGING DROP, temperature 292K	Resolution 3.00 Å R-free 0.286
2	Protein heterocomplex Heteromer Protein × 6 PDB declaration: hexameric（6） Consistent with protein copy count	Chain D； UniProt 82–285 Chain E； UniProt 82–285 Chain F； UniProt 82–285	Fragment：TNF domain	BR3 derived PEPTIDE × 3 MG MAGNESIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6.7；292 K；20% PEG 3350, 1.0 M LiCl, 0.1M sodium cacodylate, pH 6.7, VAPOR DIFFUSION, HANGING DROP, temperature 292K	Resolution 3.00 Å R-free 0.286

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 1OSG	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1JH5 Crystal Structure of sTALL-1 of TNF family ligand Deposited 2001-06-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 60 PDB declaration: 60-meric	Chain A 142–285（144 aa） Fragment：sTALL-1, soluble part of TALL-1 Chain B 142–285（144 aa） Fragment：sTALL-1, soluble part of TALL-1 Chain C 142–285（144 aa） Fragment：sTALL-1, soluble part of TALL-1 Chain D 142–285（144 aa） Fragment：sTALL-1, soluble part of TALL-1 Chain E 142–285（144 aa） Fragment：sTALL-1, soluble part of TALL-1 Chain F 142–285（144 aa） Fragment：sTALL-1, soluble part of TALL-1 Chain G 142–285（144 aa） Fragment：sTALL-1, soluble part of TALL-1 Chain H 142–285（144 aa） Fragment：sTALL-1, soluble part of TALL-1 Chain I 142–285（144 aa） Fragment：sTALL-1, soluble part of TALL-1 Chain J 142–285（144 aa） Fragment：sTALL-1, soluble part of TALL-1	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9；277 K；35% dioxane, pH 9.0, VAPOR DIFFUSION, HANGING DROP at 277K	Resolution 3.00 Å R-free 0.252
1KD7 Crystal structure of an extracellular domain fragment of human BAFF Deposited 2001-11-12	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 122–285（164 aa） Fragment：Extracellular domain fragment Chain B 122–285（164 aa） Fragment：Extracellular domain fragment Chain C 122–285（164 aa） Fragment：Extracellular domain fragment	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.5；277 K；8% PEG 4000, 0.1 M sodium acetatesolution of 8% PEG 4000, 0.1 M sodium acetate pH 4.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.80 Å R-free 0.250
1KD7 Crystal structure of an extracellular domain fragment of human BAFF Deposited 2001-11-12	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain K 122–285（164 aa） Fragment：Extracellular domain fragment Chain L 122–285（164 aa） Fragment：Extracellular domain fragment Chain M 122–285（164 aa） Fragment：Extracellular domain fragment	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.5；277 K；8% PEG 4000, 0.1 M sodium acetatesolution of 8% PEG 4000, 0.1 M sodium acetate pH 4.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.80 Å R-free 0.250
1KXG The 2.0 Ang Resolution Structure of BLyS, B Lymphocyte Stimulator. Deposited 2002-01-31	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain A 134–285（152 aa） Fragment：soluble portion (residues 134-285) Chain B 134–285（152 aa） Fragment：soluble portion (residues 134-285) Chain C 134–285（152 aa） Fragment：soluble portion (residues 134-285)	Not recorded	MG MAGNESIUM ION × 4 CIT CITRIC ACID × 1 DIO 1,4-DIETHYLENE DIOXIDE × 13	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；279 K；25% dioxane, 25 mM MgCl2, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 279.0K	Resolution 2.00 Å R-free 0.209
1KXG The 2.0 Ang Resolution Structure of BLyS, B Lymphocyte Stimulator. Deposited 2002-01-31	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 3 PDB declaration: trimeric	Chain D 134–285（152 aa） Fragment：soluble portion (residues 134-285) Chain E 134–285（152 aa） Fragment：soluble portion (residues 134-285) Chain F 134–285（152 aa） Fragment：soluble portion (residues 134-285)	Not recorded	MG MAGNESIUM ION × 3 CIT CITRIC ACID × 1 DIO 1,4-DIETHYLENE DIOXIDE × 7	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；279 K；25% dioxane, 25 mM MgCl2, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 279.0K	Resolution 2.00 Å R-free 0.209
1OQD Crystal structure of sTALL-1 and BCMA Deposited 2003-03-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 108 PDB declaration: 108-meric	Chain A 142–285（144 aa） Fragment：extracellular domain Chain B 142–285（144 aa） Fragment：extracellular domain Chain C 142–285（144 aa） Fragment：extracellular domain Chain D 142–285（144 aa） Fragment：extracellular domain Chain E 142–285（144 aa） Fragment：extracellular domain Chain F 142–285（144 aa） Fragment：extracellular domain Chain G 142–285（144 aa） Fragment：extracellular domain Chain H 142–285（144 aa） Fragment：extracellular domain Chain I 142–285（144 aa） Fragment：extracellular domain Chain J 142–285（144 aa） Fragment：extracellular domain	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9；277 K；dioxane, pH 9.0, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.60 Å R-free 0.260
1OQE Crystal structure of sTALL-1 with BAFF-R Deposited 2003-03-07	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 108 PDB declaration: 108-meric	Chain A 142–285（144 aa） Fragment：extracellular domain Chain B 142–285（144 aa） Fragment：extracellular domain Chain C 142–285（144 aa） Fragment：extracellular domain Chain D 142–285（144 aa） Fragment：extracellular domain Chain E 142–285（144 aa） Fragment：extracellular domain Chain F 142–285（144 aa） Fragment：extracellular domain Chain G 142–285（144 aa） Fragment：extracellular domain Chain H 142–285（144 aa） Fragment：extracellular domain Chain I 142–285（144 aa） Fragment：extracellular domain Chain J 142–285（144 aa） Fragment：extracellular domain	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 9；dioxane, pH 9.0, VAPOR DIFFUSION, HANGING DROP, temperature 100K	Resolution 2.50 Å R-free 0.259
3V56 Re-refinement of PDB entry 1OSG - Complex between BAFF and a BR3 derived peptide presented in a beta-hairpin scaffold - reveals an additonal copy of the peptide. Deposited 2011-12-16	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 82–285（204 aa） Chain B 82–285（204 aa） Chain C 82–285（204 aa）	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å R-free 0.200
3V56 Re-refinement of PDB entry 1OSG - Complex between BAFF and a BR3 derived peptide presented in a beta-hairpin scaffold - reveals an additonal copy of the peptide. Deposited 2011-12-16	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain D 82–285（204 aa） Chain E 82–285（204 aa） Chain F 82–285（204 aa）	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 3.00 Å R-free 0.200
4V46 Crystal structure of the BAFF-BAFF-R complex Deposited 2003-03-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 120 PDB declaration: 120-meric	Chain A0 138–285（148 aa） Fragment：residues 138-285 Chain A1 138–285（148 aa） Fragment：residues 138-285 Chain A2 138–285（148 aa） Fragment：residues 138-285 Chain A3 138–285（148 aa） Fragment：residues 138-285 Chain A4 138–285（148 aa） Fragment：residues 138-285 Chain A5 138–285（148 aa） Fragment：residues 138-285 Chain A6 138–285（148 aa） Fragment：residues 138-285 Chain A7 138–285（148 aa） Fragment：residues 138-285 Chain A8 138–285（148 aa） Fragment：residues 138-285 Chain A9 138–285（148 aa） Fragment：residues 138-285 Chain AA 138–285（148 aa） Fragment：residues 138-285 Chain AB 138–285（148 aa） Fragment：residues 138-285 Chain AC 138–285（148 aa） Fragment：residues 138-285 Chain AD 138–285（148 aa） Fragment：residues 138-285 Chain AE 138–285（148 aa） Fragment：residues 138-285 Chain AF 138–285（148 aa） Fragment：residues 138-285 Chain AG 138–285（148 aa） Fragment：residues 138-285 Chain AH 138–285（148 aa） Fragment：residues 138-285 Chain AI 138–285（148 aa） Fragment：residues 138-285 Chain AJ 138–285（148 aa） Fragment：residues 138-285 Chain AK 138–285（148 aa） Fragment：residues 138-285 Chain AL 138–285（148 aa） Fragment：residues 138-285 Chain AM 138–285（148 aa） Fragment：residues 138-285 Chain AN 138–285（148 aa） Fragment：residues 138-285 Chain AO 138–285（148 aa） Fragment：residues 138-285 Chain AP 138–285（148 aa） Fragment：residues 138-285 Chain AQ 138–285（148 aa） Fragment：residues 138-285 Chain AR 138–285（148 aa） Fragment：residues 138-285 Chain AS 138–285（148 aa） Fragment：residues 138-285 Chain AT 138–285（148 aa） Fragment：residues 138-285 Chain AU 138–285（148 aa） Fragment：residues 138-285 Chain AV 138–285（148 aa） Fragment：residues 138-285 Chain AW 138–285（148 aa） Fragment：residues 138-285 Chain AX 138–285（148 aa） Fragment：residues 138-285 Chain AY 138–285（148 aa） Fragment：residues 138-285 Chain AZ 138–285（148 aa） Fragment：residues 138-285 Chain Aa 138–285（148 aa） Fragment：residues 138-285 Chain Ab 138–285（148 aa） Fragment：residues 138-285 Chain Ac 138–285（148 aa） Fragment：residues 138-285 Chain Ad 138–285（148 aa） Fragment：residues 138-285 Chain Ae 138–285（148 aa） Fragment：residues 138-285 Chain Af 138–285（148 aa） Fragment：residues 138-285 Chain Ag 138–285（148 aa） Fragment：residues 138-285 Chain Ah 138–285（148 aa） Fragment：residues 138-285 Chain Ai 138–285（148 aa） Fragment：residues 138-285 Chain Aj 138–285（148 aa） Fragment：residues 138-285 Chain Ak 138–285（148 aa） Fragment：residues 138-285 Chain Al 138–285（148 aa） Fragment：residues 138-285 Chain Am 138–285（148 aa） Fragment：residues 138-285 Chain An 138–285（148 aa） Fragment：residues 138-285 Chain Ao 138–285（148 aa） Fragment：residues 138-285 Chain Ap 138–285（148 aa） Fragment：residues 138-285 Chain Aq 138–285（148 aa） Fragment：residues 138-285 Chain Ar 138–285（148 aa） Fragment：residues 138-285 Chain As 138–285（148 aa） Fragment：residues 138-285 Chain At 138–285（148 aa） Fragment：residues 138-285 Chain Au 138–285（148 aa） Fragment：residues 138-285 Chain Av 138–285（148 aa） Fragment：residues 138-285 Chain Aw 138–285（148 aa） Fragment：residues 138-285 Chain Ax 138–285（148 aa） Fragment：residues 138-285	Not recorded	MG MAGNESIUM ION × 40	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；277 K；sodium formate, pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 3.30 Å R-free 0.226
4ZCH Single-chain human APRIL-BAFF-BAFF Heterotrimer Deposited 2015-04-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain A 140–285（146 aa）	Not recorded	144 TRIS-HYDROXYMETHYL-METHYL-AMMONIUM × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；293 K；RESERVOIR SOLUTION : 14% PEG6000 , 1M LiCL , TRIS-HCL pH 8.50	Resolution 2.43 Å R-free 0.234
4ZCH Single-chain human APRIL-BAFF-BAFF Heterotrimer Deposited 2015-04-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Monomer；Protein × 1 PDB declaration: monomeric	Chain B 140–285（146 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；293 K；RESERVOIR SOLUTION : 14% PEG6000 , 1M LiCL , TRIS-HCL pH 8.50	Resolution 2.43 Å R-free 0.234
5Y9J BAFF in complex with belimumab Deposited 2017-08-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 134–285（152 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 8.5；293 K；0.1 M Tris(hydroxymethyl)aminomethane pH 8.5, 20% (w/v)polyethylene glycol 1,000	Resolution 2.05 Å R-free 0.217
6FXN Crystal structure of human BAFF in complex with Fab fragment of anti-BAFF antibody belimumab Deposited 2018-03-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain A 134–285（152 aa） Chain B 134–285（152 aa） Chain C 134–285（152 aa）	Mutation：H218A Mutation：H218A Mutation：H218A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；9% (w/v) PEG4000, 0.1 M MgCl2, 0.1 M HEPES pH 7.5	Resolution 2.90 Å R-free 0.231
6FXN Crystal structure of human BAFF in complex with Fab fragment of anti-BAFF antibody belimumab Deposited 2018-03-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 9 PDB declaration: nonameric	Chain J 134–285（152 aa） Chain K 134–285（152 aa） Chain L 134–285（152 aa）	Mutation：H218A Mutation：H218A Mutation：H218A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；293 K；9% (w/v) PEG4000, 0.1 M MgCl2, 0.1 M HEPES pH 7.5	Resolution 2.90 Å R-free 0.231
8ZUJ Pentagonal cluster of BAFF-BAFFR ectodomain complex Deposited 2024-06-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain D 134–285（152 aa） Chain E 134–285（152 aa） Chain F 134–285（152 aa） Chain J 134–285（152 aa） Chain K 134–285（152 aa） Chain L 134–285（152 aa） Chain P 134–285（152 aa） Chain Q 134–285（152 aa） Chain R 134–285（152 aa） Chain V 134–285（152 aa） Chain W 134–285（152 aa） Chain X 134–285（152 aa） Chain b 134–285（152 aa） Chain c 134–285（152 aa） Chain d 134–285（152 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer pH 7.8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.58 Å

11 other PDB entries and 16 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	TN13B_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 5–208； UniProt 82–285 Author chain B； PDBConstruct 5–208； UniProt 82–285 Author chain C； PDBConstruct 5–208； UniProt 82–285 Author chain D； PDBConstruct 5–208； UniProt 82–285 Author chain E； PDBConstruct 5–208； UniProt 82–285 Author chain F； PDBConstruct 5–208； UniProt 82–285

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1osg
Deposition date deposition_date	2003-03-19
Structure title title	Complex between BAFF and a BR3 derived peptide presented in a beta-hairpin scaffold
Keywords keywords	jelly-roll, beta hairpin, protein-peptide complex, IMMUNE SYSTEM; IMMUNE SYSTEM
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	33.30 Å
Radius of gyration Rg (electron density) rg_electron	32.71 Å
Forward intensity I(0) i0	163614000.00
Molecular weight molecular_weight	106680.0 kDa
Excluded volume excluded_volume	135130 Å³
Envelope volume envelope_volume	164550 Å³
Hydration-shell volume shell_volume	41691 Å³
Envelope diameter envelope_diameter	108.4 Å
Shell Rg shell_rg	39.50 Å
Envelope Rg envelope_rg	32.95 Å
Shape Rg shape_rg	32.69 Å
Total Rg total_rg	33.29 Å
Total atoms total_atoms	7511
Residues n_residues	936
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	110.0 Å
Rg (real space) rg_real	33.44 Å
Rg uncertainty (real space) rg_real_error	0.71 Å
I(0) (real space) i0_real	1.6360e+08
I(0) uncertainty (real space) i0_real_error	2.4030e+06
Rg (reciprocal space) rg_reciprocal	33.39 Å
I(0) (reciprocal space) i0_reciprocal	163600000.0000
Solution quality estimate total_estimate	0.8629
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	32.1 Å
Skewness Skewness skewness	0.404
Kurtosis Kurtosis kurtosis	-0.551
Angular range angular_range	— – 0.2400 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	102600000.0000
Real-space data points n_real_points	49
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.798; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.931; Smooth: 0.888

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Tumor necrosis factor ligand superfamily member 13B
Molecular weight formula_weight	22746.8 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F
Atom count atom_count	7531

GSHMELQGHHAEKLPAGAGAPKAGLEEAPAVTAGLKIFEPPAPGEGNSSQNSRNKRAVQGPEETVTQDCLQLIADSETPTIQKGSYTFVPWLLSFKRGSALEEKENKILVKETGYFFIYGQVLYTDKTYAMGHLIQRKKVHVFGDELSLVTLFRCIQNMPETLPNNSCYSAGIAKLEEGDELQLAIPRENAQISLDGDVTFFGALKLL

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli BL21(DE3)

Entity 2 Entity 2 polymer

Description description	BR3 derived PEPTIDE
Molecular weight formula_weight	1569.9 kDa
Source method src_method	syn
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,J,H,I,K,L

CHWDLLVRHWVC

Entity 3 Entity 3 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	20

▼

7. Fold Classification (SCOP + CATH) 12 domains

SCOP 2.08 (6 domains)

Domain ID domain_id	d1osga_
Class class	b — All beta proteins
Fold Fold fold	b.22 — TNF-like
Superfamily Superfamily superfamily	b.22.1 — TNF-like
Family Family family	b.22.1.1 — TNF-like

Domain ID domain_id	d1osgb_
Class class	b — All beta proteins
Fold Fold fold	b.22 — TNF-like
Superfamily Superfamily superfamily	b.22.1 — TNF-like
Family Family family	b.22.1.1 — TNF-like

Domain ID domain_id	d1osgc_
Class class	b — All beta proteins
Fold Fold fold	b.22 — TNF-like
Superfamily Superfamily superfamily	b.22.1 — TNF-like
Family Family family	b.22.1.1 — TNF-like

Domain ID domain_id	d1osgd_
Class class	b — All beta proteins
Fold Fold fold	b.22 — TNF-like
Superfamily Superfamily superfamily	b.22.1 — TNF-like
Family Family family	b.22.1.1 — TNF-like

Domain ID domain_id	d1osge_
Class class	b — All beta proteins
Fold Fold fold	b.22 — TNF-like
Superfamily Superfamily superfamily	b.22.1 — TNF-like
Family Family family	b.22.1.1 — TNF-like

Domain ID domain_id	d1osgf_
Class class	b — All beta proteins
Fold Fold fold	b.22 — TNF-like
Superfamily Superfamily superfamily	b.22.1 — TNF-like
Family Family family	b.22.1.1 — TNF-like

CATH v4.4 (6 domains)

Domain ID domain_id	1osgA00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	40 —

Domain ID domain_id	1osgB00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	40 —

Domain ID domain_id	1osgC00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	40 —

Domain ID domain_id	1osgD00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	40 —

Domain ID domain_id	1osgE00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	40 —

Domain ID domain_id	1osgF00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	40 —

▶

8. Citations (1)

▶

Unit-cell length a length_a	121.633 Å
Unit-cell length b length_b	121.633 Å
Unit-cell length c length_c	157.214 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	36

Space group space_group	P 65
Space-group number int_tables_number	170
Crystal system crystal_system	—

Resolution resolution	3.000 Å
Low-resolution limit resolution_low	30.000 Å
R factor r_factor	0.2199
R_work r_work	0.2129
R_free r_free	0.2863

fit	/app/data/saxs_computation/os/1osg/1osg.fit
pddf	/app/data/pr_computation/os/1osg/1osg.pr.out
profile	/app/data/saxs_computation/os/1osg/1osg.dat

Complex between BAFF and a BR3 derived peptide presented in a beta-hairpin scaffold

1. Protein Identity and Related Structures Protein Identity & Related Structures

Tumor necrosis factor ligand superfamily member 13B

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

7. Fold Classification (SCOP + CATH) 12 domains

SCOP 2.08 (6 domains)

CATH v4.4 (6 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)