SAXSdb — 1p35

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

P35

Autographa californica nucleopolyhedrovirus

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 2	PHOSPHATE ION × 2 1,2-ETHANEDIOL × 2 water × 2	Consistent with protein count
2	Protein homooligomer	Homooligomer	Protein 2	PHOSPHATE ION × 2 1,2-ETHANEDIOL × 2 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	VP35_NPVAC
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–298； UniProt 2–299 Author chain B； PDBConstruct 1–298； UniProt 2–299 Author chain C； PDBConstruct 1–298； UniProt 2–299

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1p35
Deposition date deposition_date	1998-09-18
Structure title title	CRYSTAL STRUCTURE OF BACULOVIRUS P35
Keywords keywords	APOPTOSIS, P35, CELL DEATH, BACULOVIRUS; APOPTOSIS
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1p35__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1p35__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1p35__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	29.70 Å
Rg (electron density)	29.45 Å
Total Rg	30.14 Å
Atom count	4824
Residues	594
Excluded volume	86107 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1p35__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`1p35__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	P35
Molecular weight formula_weight	34813.5 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C
Atom count atom_count	7538

CVIFPVEIDVSQTIIRDCQVDKQTRELVYINKIMNTQLTKPVLMMFNISGPIRSVTRKNNNLRDRIKSKVDEQFDQLERDYSDQMDGFHDSIKYFKDEHYSVSCQNGSVLKSKFAKILKSHDYTDKKSIEAYEKYCLPKLVDERNDYYVAVCVLKPGFENGSNQVLSFEYNPIGNKVIVPFAHEINDTGLYEYDVVAYVDSVQFDGEQFEEFVQSLILPSSFKNSEKVLYYNEASKNKSMIYKALEFTTESSWGKSEKYNWKIFCNGFIYDKKSKVLYVKLHNVTSALNKNVILNTIKA

Source Source

Source organism organism	Autographa californica nucleopolyhedrovirus
NCBI taxonomy ID ncbi_taxonomy_id	46015
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	PHOSPHATE ION
Molecular weight formula_weight	95.0 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 3 Entity 3 non-polymer

Description description	1,2-ETHANEDIOL
Molecular weight formula_weight	62.1 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	267

▼

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (3 domains)

Domain ID domain_id	d1p35a_
Class class	b — All beta proteins
Fold Fold fold	b.28 — Baculovirus p35 protein
Superfamily Superfamily superfamily	b.28.1 — Baculovirus p35 protein
Family Family family	b.28.1.1 — Baculovirus p35 protein

Domain ID domain_id	d1p35b_
Class class	b — All beta proteins
Fold Fold fold	b.28 — Baculovirus p35 protein
Superfamily Superfamily superfamily	b.28.1 — Baculovirus p35 protein
Family Family family	b.28.1.1 — Baculovirus p35 protein

Domain ID domain_id	d1p35c_
Class class	b — All beta proteins
Fold Fold fold	b.28 — Baculovirus p35 protein
Superfamily Superfamily superfamily	b.28.1 — Baculovirus p35 protein
Family Family family	b.28.1.1 — Baculovirus p35 protein

CATH v4.4 (3 domains)

Domain ID domain_id	1p35A00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	250 — Baculovirus p35
Homologous superfamily homologous superfamily	10 — Baculovirus p35

Domain ID domain_id	1p35B00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	250 — Baculovirus p35
Homologous superfamily homologous superfamily	10 — Baculovirus p35

Domain ID domain_id	1p35C00
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	250 — Baculovirus p35
Homologous superfamily homologous superfamily	10 — Baculovirus p35

▶

Unit-cell length a length_a	114.580 Å
Unit-cell length b length_b	130.110 Å
Unit-cell length c length_c	181.080 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	24

Space group space_group	C 2 2 21
Space-group number int_tables_number	20
Crystal system crystal_system	—

Resolution resolution	2.200 Å
Low-resolution limit resolution_low	30.000 Å
R factor r_factor	0.1960
R_work r_work	0.1960
R_free r_free	0.2620

CRYSTAL STRUCTURE OF BACULOVIRUS P35

1. Protein Identity and Related Structures Protein Identity & Related Structures

P35

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1p35__assembly_1__model_1

1p35__assembly_1__model_1 | I(q)

1p35__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (3 domains)

CATH v4.4 (3 domains)

7. Citations (1)

CRYSTAL STRUCTURE OF BACULOVIRUS P35

1. Protein Identity and Related Structures Protein Identity & Related Structures

P35

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1p35__assembly_1__model_1

1p35__assembly_1__model_1 | I(q)

1p35__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (3 domains)

CATH v4.4 (3 domains)

7. Citations (1)