SAXSdb — 1pq1

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Apoptosis regulator Bcl-X

Mus musculus

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 1–196	Fragment：BIM	BCL2-like protein 11 × 1 （O54918）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 4.5；298 K；NH4H2PO4, pH 4.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.65 Å R-free 0.237

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 1PQ1	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1PQ0 Crystal structure of mouse Bcl-xl Deposited 2003-06-17	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–196（196 aa） Fragment：Bcl-xl	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；298 K；NH4SO4, MES, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.20 Å R-free 0.243
2BZW The crystal structure of BCL-XL in complex with full-length BAD Deposited 2005-08-24	Different construct Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–211（211 aa） Fragment：BCL-2 HOMOLOGY DOMAIN, RESIDUES 1-211	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.30 Å R-free 0.248
3IHC Crystal structure of mouse Bcl-xl (wt) at pH 5.0 Deposited 2009-07-30	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–196（196 aa） Fragment：UNP residues 1-196	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5；295 K；1.6M Ammonium sulphate, Tri-Na citrate (pH 5.0), VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 1.85 Å R-free 0.242
3IHD Crystal structure of mouse Bcl-xl mutant (Y101A) at pH 5.0 Deposited 2009-07-30	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–196（196 aa） Fragment：UNP residues 1-196	Mutation：Y101A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5；295 K；1.4M Ammonium Sulphate, Tri-Na citrate, pH 5.0, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 1.88 Å R-free 0.210
3IHE Crystal structure of mouse Bcl-xl mutant (F105A) at pH 6.0 Deposited 2009-07-30	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–196（196 aa） Fragment：UNP residues 1-196	Mutation：F105A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；295 K；1.7M Ammonium sulphate, MES, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 3.00 Å R-free 0.239
3IHF Crystal structure of mouse Bcl-xl mutant (R139A) at pH 5.0 Deposited 2009-07-30	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–196（196 aa） Fragment：UNP residues 1-196	Mutation：R139A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5；295 K；1.45M Ammonium sulphate, Tri-Na citrate, pH 5.0, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.28 Å R-free 0.266
3IHF Crystal structure of mouse Bcl-xl mutant (R139A) at pH 5.0 Deposited 2009-07-30	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1–196（196 aa） Fragment：UNP residues 1-196	Mutation：R139A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5；295 K；1.45M Ammonium sulphate, Tri-Na citrate, pH 5.0, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.28 Å R-free 0.266
3IHF Crystal structure of mouse Bcl-xl mutant (R139A) at pH 5.0 Deposited 2009-07-30	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 1–196（196 aa） Fragment：UNP residues 1-196	Mutation：R139A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5；295 K；1.45M Ammonium sulphate, Tri-Na citrate, pH 5.0, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.28 Å R-free 0.266
3IHF Crystal structure of mouse Bcl-xl mutant (R139A) at pH 5.0 Deposited 2009-07-30	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 1–196（196 aa） Fragment：UNP residues 1-196	Mutation：R139A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5；295 K；1.45M Ammonium sulphate, Tri-Na citrate, pH 5.0, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.28 Å R-free 0.266
3IIG Crystal structure of mouse Bcl-xl mutant (F105A) at pH 5.0 Deposited 2009-08-01	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–196（196 aa） Fragment：UNP residues 1-196	Mutation：F105A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5；295 K；1.6M Ammonium sulphate, 0.1M tri-Na citrate, pH 5.0, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.30 Å R-free 0.269
3IIH Crystal structure of mouse Bcl-xl (wt) at pH 6.0 Deposited 2009-08-01	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–196（196 aa） Fragment：UNP residues 1-196	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6；295 K；1.0M Ammonium sulphate, 0.4M Lithium sulphate, MES, pH 6.0, VAPOR DIFFUSION, SITTING DROP, temperature 295K	Resolution 2.75 Å R-free 0.275
3ILB Crystal structure of mouse Bcl-xl mutant (R139A) at pH 6.0 Deposited 2009-08-07	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–196（196 aa） Fragment：UNP residues 1-196	Mutation：R139A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；295 K；1.2M Ammonium sulphate, 0.3M Lithium sulphate, MES, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.38 Å R-free 0.293
3ILB Crystal structure of mouse Bcl-xl mutant (R139A) at pH 6.0 Deposited 2009-08-07	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain N 1–196（196 aa） Fragment：UNP residues 1-196	Mutation：R139A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；295 K；1.2M Ammonium sulphate, 0.3M Lithium sulphate, MES, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 2.38 Å R-free 0.293
3ILC Crystal structure of mouse Bcl-xl mutant (Y101A) at pH 6.0 Deposited 2009-08-07	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–196（196 aa） Fragment：UNP residues 1-196	Mutation：Y101A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；295 K；1.6M Ammonium sulphate, MES, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 1.64 Å R-free 0.244
4YJ4 Crystal structure of Bcl-xL in complex with the BIM BH3 domain containing Ile155-to-Arg and Glu158-to-phosphoserine mutations Deposited 2015-03-03	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–196（196 aa）	Mutation：M83E, A84S	ACT ACETATE ION × 1 CL CHLORIDE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 4.8；293 K；0.1 M sodium acetate (pH 4.8), 3.0 M sodium chloride	Resolution 2.10 Å R-free 0.211
4YK9 Complex structure of BCL-XL and mutated BIM BH3 domain Deposited 2015-03-04	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 2–196（195 aa） Fragment：UNP RESIDUES 2-196	Not recorded	ACT ACETATE ION × 2 CL CHLORIDE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；287 K；0.1 M sodium acetate (pH 4.6), 0.01 M calcium chloride and 15% v/v 2-methyl-2,4-pentanediol	Resolution 1.70 Å R-free 0.228
4YK9 Complex structure of BCL-XL and mutated BIM BH3 domain Deposited 2015-03-04	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 2–196（195 aa） Fragment：UNP RESIDUES 2-196	Not recorded	ACT ACETATE ION × 1 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4.6；287 K；0.1 M sodium acetate (pH 4.6), 0.01 M calcium chloride and 15% v/v 2-methyl-2,4-pentanediol	Resolution 1.70 Å R-free 0.228
5C3G Crystal structure of Bcl-xl bound to BIM-MM Deposited 2015-06-17	Different construct Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–26（26 aa） Fragment：UNP residues 1-26,UNP residues 83-209	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；12% Peg 1500, 0.1M Sodium Acetate pH 5.5, 2.5M NaCl, 1.5% MPD	Resolution 2.45 Å R-free 0.274
7WJH Crystal structure of Bcl-xL bound to the BH3 domain of human Pxt1 Deposited 2022-01-06	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–42（42 aa） Chain A 85–196（112 aa）	Not recorded	SO4 SULFATE ION × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；291 K；0.2 M ammonium sulfate and 30% (w/v) polyethylene glycol 8,000	Resolution 1.70 Å R-free 0.207
7Y99 Crystal Structure Analysis of cp2 bound BCLxl Deposited 2022-06-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–26（26 aa） Chain A 82–196（115 aa）	Not recorded	IQ8 N-(2-acetamidoethyl)-4-(4,5-dihydro-1,3-thiazol-2-yl)benzamide × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；277 K；Ammonium acetate, BIS-TRIS, MPD	Resolution 1.90 Å R-free 0.192

15 other PDB entries and 20 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	BCLX_MOUSE
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–196； UniProt 1–196

BCL2-like protein 11

Mus musculus

UniProt O54918

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain B； UniProt 83–115	Not recorded	Apoptosis regulator Bcl-X × 1 （Q64373）	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 4.5；298 K；NH4H2PO4, pH 4.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.65 Å R-free 0.237

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

No other PDB entry for the same UniProt protein was found.

View Construct and Data Evidence

UniProt name	BIM_MOUSE
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–33； UniProt 83–115

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1pq1
Deposition date deposition_date	2003-06-17
Structure title title	Crystal structure of Bcl-xl/Bim
Keywords keywords	Bcl-xl/Bim, APOPTOSIS; APOPTOSIS
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	17.22 Å
Radius of gyration Rg (electron density) rg_electron	15.79 Å
Forward intensity I(0) i0	8080240.00
Molecular weight molecular_weight	20617.0 kDa
Excluded volume excluded_volume	25662 Å³
Envelope volume envelope_volume	28979 Å³
Hydration-shell volume shell_volume	15370 Å³
Envelope diameter envelope_diameter	59.6 Å
Shell Rg shell_rg	21.88 Å
Envelope Rg envelope_rg	16.31 Å
Shape Rg shape_rg	15.77 Å
Total Rg total_rg	16.89 Å
Total atoms total_atoms	1458
Residues n_residues	180
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	58.5 Å
Rg (real space) rg_real	17.13 Å
Rg uncertainty (real space) rg_real_error	0.39 Å
I(0) (real space) i0_real	8.0800e+06
I(0) uncertainty (real space) i0_real_error	1.0440e+05
Rg (reciprocal space) rg_reciprocal	17.14 Å
I(0) (reciprocal space) i0_reciprocal	8080000.0000
Solution quality estimate total_estimate	0.7746
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	3
Primary peak position r_peak_primary	23.1 Å
Skewness Skewness skewness	0.233
Kurtosis Kurtosis kurtosis	-0.092
Angular range angular_range	— – 0.4600 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	1943000.0000
Real-space data points n_real_points	77
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.689; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 1.000; Smooth: 0.000

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Apoptosis regulator Bcl-X
Molecular weight formula_weight	22056.2 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	1627

MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEAERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIASWMATYLNDHLEPWIQENGGWDTFVDLYG

来源 Source

来源生物 organism	Mus musculus
通用名 common_name	house mouse
NCBI Class编号 ncbi_taxonomy_id	10090
宿主生物 host_organism	Trichoplusia ni

Entity 2 Entity 2 polymer

Description description	BCL2-like protein 11
Molecular weight formula_weight	4120.6 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

DLRPEIRIAQELRRIGDEFNETYTRRVFANDYR

来源 Source

来源生物 organism	Mus musculus
通用名 common_name	house mouse
NCBI Class编号 ncbi_taxonomy_id	10090
宿主生物 host_organism	Trichoplusia ni

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	169

▼

7. Fold Classification (SCOP + CATH) 3 domains

SCOP 2.08 (2 domains)

Domain ID domain_id	d1pq1a_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.1 — Toxins' membrane translocation domains
Superfamily Superfamily superfamily	f.1.4 — Bcl-2 inhibitors of programmed cell death
Family Family family	f.1.4.1 — Bcl-2 inhibitors of programmed cell death

Domain ID domain_id	d1pq1b_
Class class	j — Peptides
Fold Fold fold	j.35 — Transmembrane helical fragments
Superfamily Superfamily superfamily	j.35.1 — Transmembrane helical fragments
Family Family family	j.35.1.1 — Transmembrane helical fragments

CATH v4.4 (1 domains)

Domain ID domain_id	1pq1A00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	437 — Apoptosis Regulator Bcl-x
Homologous superfamily homologous superfamily	10 — Blc2-like

▶

8. Citations (1)

▶

Unit-cell length a length_a	39.100 Å
Unit-cell length b length_b	47.340 Å
Unit-cell length c length_c	49.280 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	110.10 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	2

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	1.650 Å
Low-resolution limit resolution_low	19.900 Å
R factor r_factor	0.2190
R_work r_work	0.2190
R_free r_free	0.2370

fit	/app/data/saxs_computation/pq/1pq1/1pq1.fit
pddf	/app/data/pr_computation/pq/1pq1/1pq1.pr.out
profile	/app/data/saxs_computation/pq/1pq1/1pq1.dat

Crystal structure of Bcl-xl/Bim

1. Protein Identity and Related Structures Protein Identity & Related Structures

Apoptosis regulator Bcl-X

State in the Current Structure

Other States of the Same Protein in the Database

BCL2-like protein 11

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 water

7. Fold Classification (SCOP + CATH) 3 domains

SCOP 2.08 (2 domains)

CATH v4.4 (1 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)