1pvc

REFINEMENT OF THE SABIN STRAIN OF TYPE 3 POLIOVIRUS AT 2.4 ANGSTROMS AND THE CRYSTAL STRUCTURES OF ITS VARIANTS AT 2.9 ANGSTROMS RESOLUTION

Method: X-RAY DIFFRACTION D_max: 97.0 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

POLIOVIRUS TYPE 3, SABIN STRAIN

OrganismNot specified

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 300 PDB declaration: 300-MERIC（300） Consistent with protein copy count	Chain 2； UniProt 70–340 Chain 4； UniProt 2–69	Not recorded	POLIOVIRUS TYPE 3, SABIN STRAIN × 60 POLIOVIRUS TYPE 3, SABIN STRAIN × 60 POLIOVIRUS TYPE 3, SABIN STRAIN × 60 SPH SPHINGOSINE × 60 MYR MYRISTIC ACID × 60	X-RAY DIFFRACTION mmCIF provides none of the parsed experimental conditions	Resolution 2.40 Å
2	Protein heterocomplex Heteromer Protein × 5 PDB declaration: pentameric（5） Consistent with protein copy count	Chain 2； UniProt 70–340 Chain 4； UniProt 2–69	Not recorded	POLIOVIRUS TYPE 3, SABIN STRAIN × 1 POLIOVIRUS TYPE 3, SABIN STRAIN × 1 POLIOVIRUS TYPE 3, SABIN STRAIN × 1 SPH SPHINGOSINE × 1 MYR MYRISTIC ACID × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed experimental conditions	Resolution 2.40 Å
3	Protein heterocomplex Heteromer Protein × 25 PDB declaration: 25-meric（25） Consistent with protein copy count	Chain 2； UniProt 70–340 Chain 4； UniProt 2–69	Not recorded	POLIOVIRUS TYPE 3, SABIN STRAIN × 5 POLIOVIRUS TYPE 3, SABIN STRAIN × 5 POLIOVIRUS TYPE 3, SABIN STRAIN × 5 SPH SPHINGOSINE × 5 MYR MYRISTIC ACID × 5	X-RAY DIFFRACTION mmCIF provides none of the parsed experimental conditions	Resolution 2.40 Å
4	Protein heterocomplex Heteromer Protein × 30 PDB declaration: 30-meric（30） Consistent with protein copy count	Chain 2； UniProt 70–340 Chain 4； UniProt 2–69	Not recorded	POLIOVIRUS TYPE 3, SABIN STRAIN × 6 POLIOVIRUS TYPE 3, SABIN STRAIN × 6 POLIOVIRUS TYPE 3, SABIN STRAIN × 6 SPH SPHINGOSINE × 6 MYR MYRISTIC ACID × 6	X-RAY DIFFRACTION mmCIF provides none of the parsed experimental conditions	Resolution 2.40 Å
5	Protein heterocomplex Heteromer Protein × 5 PDB declaration: pentameric（5） Consistent with protein copy count	Chain 2； UniProt 70–340 Chain 4； UniProt 2–69	Not recorded	POLIOVIRUS TYPE 3, SABIN STRAIN × 1 POLIOVIRUS TYPE 3, SABIN STRAIN × 1 POLIOVIRUS TYPE 3, SABIN STRAIN × 1 SPH SPHINGOSINE × 1 MYR MYRISTIC ACID × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed experimental conditions	Resolution 2.40 Å
6	Protein heterocomplex Heteromer Protein × 75 PDB declaration: 75-meric（75） Consistent with protein copy count	Chain 2； UniProt 70–340 Chain 4； UniProt 2–69	Not recorded	POLIOVIRUS TYPE 3, SABIN STRAIN × 15 POLIOVIRUS TYPE 3, SABIN STRAIN × 15 POLIOVIRUS TYPE 3, SABIN STRAIN × 15 SPH SPHINGOSINE × 15 MYR MYRISTIC ACID × 15	X-RAY DIFFRACTION mmCIF provides none of the parsed experimental conditions	Resolution 2.40 Å

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 1PVC	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1PIV BINDING OF THE ANTIVIRAL DRUG WIN51711 TO THE SABIN STRAIN OF TYPE 3 POLIOVIRUS: STRUCTURAL COMPARISON WITH DRUG BINDING IN RHINOVIRUS 14 Deposited 1995-02-02	Different construct Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 300 PDB declaration: complete icosahedral assembly	Chain 1 577–877（301 aa） Chain 2 69–339（271 aa） Chain 3 340–577（238 aa） Chain 4 1–68（68 aa）	Not recorded	W71 5-(7-(4-(4,5-DIHYDRO-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 60 MYR MYRISTIC ACID × 60	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.90 Å
1PIV BINDING OF THE ANTIVIRAL DRUG WIN51711 TO THE SABIN STRAIN OF TYPE 3 POLIOVIRUS: STRUCTURAL COMPARISON WITH DRUG BINDING IN RHINOVIRUS 14 Deposited 1995-02-02	Different construct Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain 1 577–877（301 aa） Chain 2 69–339（271 aa） Chain 3 340–577（238 aa） Chain 4 1–68（68 aa）	Not recorded	W71 5-(7-(4-(4,5-DIHYDRO-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 1 MYR MYRISTIC ACID × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.90 Å
1PIV BINDING OF THE ANTIVIRAL DRUG WIN51711 TO THE SABIN STRAIN OF TYPE 3 POLIOVIRUS: STRUCTURAL COMPARISON WITH DRUG BINDING IN RHINOVIRUS 14 Deposited 1995-02-02	Different construct Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 25 PDB declaration: 25-meric	Chain 1 577–877（301 aa） Chain 2 69–339（271 aa） Chain 3 340–577（238 aa） Chain 4 1–68（68 aa）	Not recorded	W71 5-(7-(4-(4,5-DIHYDRO-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 5 MYR MYRISTIC ACID × 5	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.90 Å
1PIV BINDING OF THE ANTIVIRAL DRUG WIN51711 TO THE SABIN STRAIN OF TYPE 3 POLIOVIRUS: STRUCTURAL COMPARISON WITH DRUG BINDING IN RHINOVIRUS 14 Deposited 1995-02-02	Different construct Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain 1 577–877（301 aa） Chain 2 69–339（271 aa） Chain 3 340–577（238 aa） Chain 4 1–68（68 aa）	Not recorded	W71 5-(7-(4-(4,5-DIHYDRO-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 6 MYR MYRISTIC ACID × 6	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.90 Å
1PIV BINDING OF THE ANTIVIRAL DRUG WIN51711 TO THE SABIN STRAIN OF TYPE 3 POLIOVIRUS: STRUCTURAL COMPARISON WITH DRUG BINDING IN RHINOVIRUS 14 Deposited 1995-02-02	Different construct Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain 1 577–877（301 aa） Chain 2 69–339（271 aa） Chain 3 340–577（238 aa） Chain 4 1–68（68 aa）	Not recorded	W71 5-(7-(4-(4,5-DIHYDRO-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 1 MYR MYRISTIC ACID × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.90 Å
1PIV BINDING OF THE ANTIVIRAL DRUG WIN51711 TO THE SABIN STRAIN OF TYPE 3 POLIOVIRUS: STRUCTURAL COMPARISON WITH DRUG BINDING IN RHINOVIRUS 14 Deposited 1995-02-02	Different construct Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 75 PDB declaration: 75-meric	Chain 1 577–877（301 aa） Chain 2 69–339（271 aa） Chain 3 340–577（238 aa） Chain 4 1–68（68 aa）	Not recorded	W71 5-(7-(4-(4,5-DIHYDRO-2-OXAZOLYL)PHENOXY)HEPTYL)-3-METHYL ISOXAZOLE × 15 MYR MYRISTIC ACID × 15	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.90 Å
1VBA POLIOVIRUS (TYPE 3, SABIN STRAIN) (P3/SABIN, P3/LEON/12A(1)B) COMPLEXED WITH R78206 Deposited 1996-01-02	Different construct Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 300 PDB declaration: complete icosahedral assembly	Chain 1 578–877（300 aa） Chain 2 69–339（271 aa） Chain 3 340–574（235 aa） Chain 4 1–68（68 aa）	Not recorded	J78 (METHYLPYRIDAZINE PIPERIDINE PROPYLOXYPHENYL)ETHYLACETATE × 60 MYR MYRISTIC ACID × 60	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.90 Å
1VBA POLIOVIRUS (TYPE 3, SABIN STRAIN) (P3/SABIN, P3/LEON/12A(1)B) COMPLEXED WITH R78206 Deposited 1996-01-02	Different construct Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain 1 578–877（300 aa） Chain 2 69–339（271 aa） Chain 3 340–574（235 aa） Chain 4 1–68（68 aa）	Not recorded	J78 (METHYLPYRIDAZINE PIPERIDINE PROPYLOXYPHENYL)ETHYLACETATE × 1 MYR MYRISTIC ACID × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.90 Å
1VBA POLIOVIRUS (TYPE 3, SABIN STRAIN) (P3/SABIN, P3/LEON/12A(1)B) COMPLEXED WITH R78206 Deposited 1996-01-02	Different construct Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 25 PDB declaration: 25-meric	Chain 1 578–877（300 aa） Chain 2 69–339（271 aa） Chain 3 340–574（235 aa） Chain 4 1–68（68 aa）	Not recorded	J78 (METHYLPYRIDAZINE PIPERIDINE PROPYLOXYPHENYL)ETHYLACETATE × 5 MYR MYRISTIC ACID × 5	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.90 Å
1VBA POLIOVIRUS (TYPE 3, SABIN STRAIN) (P3/SABIN, P3/LEON/12A(1)B) COMPLEXED WITH R78206 Deposited 1996-01-02	Different construct Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain 1 578–877（300 aa） Chain 2 69–339（271 aa） Chain 3 340–574（235 aa） Chain 4 1–68（68 aa）	Not recorded	J78 (METHYLPYRIDAZINE PIPERIDINE PROPYLOXYPHENYL)ETHYLACETATE × 6 MYR MYRISTIC ACID × 6	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.90 Å
1VBA POLIOVIRUS (TYPE 3, SABIN STRAIN) (P3/SABIN, P3/LEON/12A(1)B) COMPLEXED WITH R78206 Deposited 1996-01-02	Different construct Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain 1 578–877（300 aa） Chain 2 69–339（271 aa） Chain 3 340–574（235 aa） Chain 4 1–68（68 aa）	Not recorded	J78 (METHYLPYRIDAZINE PIPERIDINE PROPYLOXYPHENYL)ETHYLACETATE × 1 MYR MYRISTIC ACID × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.90 Å
1VBA POLIOVIRUS (TYPE 3, SABIN STRAIN) (P3/SABIN, P3/LEON/12A(1)B) COMPLEXED WITH R78206 Deposited 1996-01-02	Different construct Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 75 PDB declaration: 75-meric	Chain 1 578–877（300 aa） Chain 2 69–339（271 aa） Chain 3 340–574（235 aa） Chain 4 1–68（68 aa）	Not recorded	J78 (METHYLPYRIDAZINE PIPERIDINE PROPYLOXYPHENYL)ETHYLACETATE × 15 MYR MYRISTIC ACID × 15	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.90 Å
1VBB POLIOVIRUS (TYPE 3, SABIN STRAIN) (P3/SABIN, P3/LEON/12A(1)B) COMPLEXED WITH R80633 Deposited 1996-01-02	Different construct Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 300 PDB declaration: complete icosahedral assembly	Chain 1 578–877（300 aa） Chain 2 69–339（271 aa） Chain 3 340–574（235 aa） Chain 4 1–68（68 aa）	Not recorded	J80 (METHYLPYRIDAZINE PIPERIDINE BUTYLOXYPHENYL)ETHYLACETATE × 60 MYR MYRISTIC ACID × 60	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.80 Å
1VBB POLIOVIRUS (TYPE 3, SABIN STRAIN) (P3/SABIN, P3/LEON/12A(1)B) COMPLEXED WITH R80633 Deposited 1996-01-02	Different construct Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain 1 578–877（300 aa） Chain 2 69–339（271 aa） Chain 3 340–574（235 aa） Chain 4 1–68（68 aa）	Not recorded	J80 (METHYLPYRIDAZINE PIPERIDINE BUTYLOXYPHENYL)ETHYLACETATE × 1 MYR MYRISTIC ACID × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.80 Å
1VBB POLIOVIRUS (TYPE 3, SABIN STRAIN) (P3/SABIN, P3/LEON/12A(1)B) COMPLEXED WITH R80633 Deposited 1996-01-02	Different construct Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 25 PDB declaration: 25-meric	Chain 1 578–877（300 aa） Chain 2 69–339（271 aa） Chain 3 340–574（235 aa） Chain 4 1–68（68 aa）	Not recorded	J80 (METHYLPYRIDAZINE PIPERIDINE BUTYLOXYPHENYL)ETHYLACETATE × 5 MYR MYRISTIC ACID × 5	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.80 Å
1VBB POLIOVIRUS (TYPE 3, SABIN STRAIN) (P3/SABIN, P3/LEON/12A(1)B) COMPLEXED WITH R80633 Deposited 1996-01-02	Different construct Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain 1 578–877（300 aa） Chain 2 69–339（271 aa） Chain 3 340–574（235 aa） Chain 4 1–68（68 aa）	Not recorded	J80 (METHYLPYRIDAZINE PIPERIDINE BUTYLOXYPHENYL)ETHYLACETATE × 6 MYR MYRISTIC ACID × 6	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.80 Å
1VBB POLIOVIRUS (TYPE 3, SABIN STRAIN) (P3/SABIN, P3/LEON/12A(1)B) COMPLEXED WITH R80633 Deposited 1996-01-02	Different construct Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain 1 578–877（300 aa） Chain 2 69–339（271 aa） Chain 3 340–574（235 aa） Chain 4 1–68（68 aa）	Not recorded	J80 (METHYLPYRIDAZINE PIPERIDINE BUTYLOXYPHENYL)ETHYLACETATE × 1 MYR MYRISTIC ACID × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.80 Å
1VBB POLIOVIRUS (TYPE 3, SABIN STRAIN) (P3/SABIN, P3/LEON/12A(1)B) COMPLEXED WITH R80633 Deposited 1996-01-02	Different construct Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 75 PDB declaration: 75-meric	Chain 1 578–877（300 aa） Chain 2 69–339（271 aa） Chain 3 340–574（235 aa） Chain 4 1–68（68 aa）	Not recorded	J80 (METHYLPYRIDAZINE PIPERIDINE BUTYLOXYPHENYL)ETHYLACETATE × 15 MYR MYRISTIC ACID × 15	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.80 Å
1VBC POLIOVIRUS (TYPE 3, SABIN STRAIN) (P3/SABIN, P3/LEON/12A(1)B) COMPLEXED WITH R77975 Deposited 1996-01-02	Different construct Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 300 PDB declaration: complete icosahedral assembly	Chain 1 578–877（300 aa） Chain 2 69–339（271 aa） Chain 3 340–574（235 aa） Chain 4 1–68（68 aa）	Not recorded	J77 (METHYLPYRIDAZINE PIPERIDINE ETHYLOXYPHENYL)ETHYLACETATE × 60 MYR MYRISTIC ACID × 60	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.80 Å
1VBC POLIOVIRUS (TYPE 3, SABIN STRAIN) (P3/SABIN, P3/LEON/12A(1)B) COMPLEXED WITH R77975 Deposited 1996-01-02	Different construct Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain 1 578–877（300 aa） Chain 2 69–339（271 aa） Chain 3 340–574（235 aa） Chain 4 1–68（68 aa）	Not recorded	J77 (METHYLPYRIDAZINE PIPERIDINE ETHYLOXYPHENYL)ETHYLACETATE × 1 MYR MYRISTIC ACID × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.80 Å
1VBC POLIOVIRUS (TYPE 3, SABIN STRAIN) (P3/SABIN, P3/LEON/12A(1)B) COMPLEXED WITH R77975 Deposited 1996-01-02	Different construct Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 25 PDB declaration: 25-meric	Chain 1 578–877（300 aa） Chain 2 69–339（271 aa） Chain 3 340–574（235 aa） Chain 4 1–68（68 aa）	Not recorded	J77 (METHYLPYRIDAZINE PIPERIDINE ETHYLOXYPHENYL)ETHYLACETATE × 5 MYR MYRISTIC ACID × 5	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.80 Å
1VBC POLIOVIRUS (TYPE 3, SABIN STRAIN) (P3/SABIN, P3/LEON/12A(1)B) COMPLEXED WITH R77975 Deposited 1996-01-02	Different construct Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain 1 578–877（300 aa） Chain 2 69–339（271 aa） Chain 3 340–574（235 aa） Chain 4 1–68（68 aa）	Not recorded	J77 (METHYLPYRIDAZINE PIPERIDINE ETHYLOXYPHENYL)ETHYLACETATE × 6 MYR MYRISTIC ACID × 6	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.80 Å
1VBC POLIOVIRUS (TYPE 3, SABIN STRAIN) (P3/SABIN, P3/LEON/12A(1)B) COMPLEXED WITH R77975 Deposited 1996-01-02	Different construct Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain 1 578–877（300 aa） Chain 2 69–339（271 aa） Chain 3 340–574（235 aa） Chain 4 1–68（68 aa）	Not recorded	J77 (METHYLPYRIDAZINE PIPERIDINE ETHYLOXYPHENYL)ETHYLACETATE × 1 MYR MYRISTIC ACID × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.80 Å
1VBC POLIOVIRUS (TYPE 3, SABIN STRAIN) (P3/SABIN, P3/LEON/12A(1)B) COMPLEXED WITH R77975 Deposited 1996-01-02	Different construct Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 75 PDB declaration: 75-meric	Chain 1 578–877（300 aa） Chain 2 69–339（271 aa） Chain 3 340–574（235 aa） Chain 4 1–68（68 aa）	Not recorded	J77 (METHYLPYRIDAZINE PIPERIDINE ETHYLOXYPHENYL)ETHYLACETATE × 15 MYR MYRISTIC ACID × 15	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.80 Å
1VBE POLIOVIRUS (TYPE 3, SABIN STRAIN, MUTANT 242-H2) COMPLEXED WITH R78206 Deposited 1996-01-02	Different construct Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 300 PDB declaration: complete icosahedral assembly	Chain 1 578–877（300 aa） Chain 2 69–339（271 aa） Chain 3 340–574（235 aa） Chain 4 1–68（68 aa）	Mutation：CHAIN 1, F124L, F134L Mutation：CHAIN 1, F124L, F134L Mutation：CHAIN 1, F124L, F134L Mutation：CHAIN 1, F124L, F134L	J78 (METHYLPYRIDAZINE PIPERIDINE PROPYLOXYPHENYL)ETHYLACETATE × 60 MYR MYRISTIC ACID × 60	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.80 Å
1VBE POLIOVIRUS (TYPE 3, SABIN STRAIN, MUTANT 242-H2) COMPLEXED WITH R78206 Deposited 1996-01-02	Different construct Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain 1 578–877（300 aa） Chain 2 69–339（271 aa） Chain 3 340–574（235 aa） Chain 4 1–68（68 aa）	Mutation：CHAIN 1, F124L, F134L Mutation：CHAIN 1, F124L, F134L Mutation：CHAIN 1, F124L, F134L Mutation：CHAIN 1, F124L, F134L	J78 (METHYLPYRIDAZINE PIPERIDINE PROPYLOXYPHENYL)ETHYLACETATE × 1 MYR MYRISTIC ACID × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.80 Å
1VBE POLIOVIRUS (TYPE 3, SABIN STRAIN, MUTANT 242-H2) COMPLEXED WITH R78206 Deposited 1996-01-02	Different construct Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 25 PDB declaration: 25-meric	Chain 1 578–877（300 aa） Chain 2 69–339（271 aa） Chain 3 340–574（235 aa） Chain 4 1–68（68 aa）	Mutation：CHAIN 1, F124L, F134L Mutation：CHAIN 1, F124L, F134L Mutation：CHAIN 1, F124L, F134L Mutation：CHAIN 1, F124L, F134L	J78 (METHYLPYRIDAZINE PIPERIDINE PROPYLOXYPHENYL)ETHYLACETATE × 5 MYR MYRISTIC ACID × 5	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.80 Å
1VBE POLIOVIRUS (TYPE 3, SABIN STRAIN, MUTANT 242-H2) COMPLEXED WITH R78206 Deposited 1996-01-02	Different construct Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain 1 578–877（300 aa） Chain 2 69–339（271 aa） Chain 3 340–574（235 aa） Chain 4 1–68（68 aa）	Mutation：CHAIN 1, F124L, F134L Mutation：CHAIN 1, F124L, F134L Mutation：CHAIN 1, F124L, F134L Mutation：CHAIN 1, F124L, F134L	J78 (METHYLPYRIDAZINE PIPERIDINE PROPYLOXYPHENYL)ETHYLACETATE × 6 MYR MYRISTIC ACID × 6	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.80 Å
1VBE POLIOVIRUS (TYPE 3, SABIN STRAIN, MUTANT 242-H2) COMPLEXED WITH R78206 Deposited 1996-01-02	Different construct Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain 1 578–877（300 aa） Chain 2 69–339（271 aa） Chain 3 340–574（235 aa） Chain 4 1–68（68 aa）	Mutation：CHAIN 1, F124L, F134L Mutation：CHAIN 1, F124L, F134L Mutation：CHAIN 1, F124L, F134L Mutation：CHAIN 1, F124L, F134L	J78 (METHYLPYRIDAZINE PIPERIDINE PROPYLOXYPHENYL)ETHYLACETATE × 1 MYR MYRISTIC ACID × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.80 Å
1VBE POLIOVIRUS (TYPE 3, SABIN STRAIN, MUTANT 242-H2) COMPLEXED WITH R78206 Deposited 1996-01-02	Different construct Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 75 PDB declaration: 75-meric	Chain 1 578–877（300 aa） Chain 2 69–339（271 aa） Chain 3 340–574（235 aa） Chain 4 1–68（68 aa）	Mutation：CHAIN 1, F124L, F134L Mutation：CHAIN 1, F124L, F134L Mutation：CHAIN 1, F124L, F134L Mutation：CHAIN 1, F124L, F134L	J78 (METHYLPYRIDAZINE PIPERIDINE PROPYLOXYPHENYL)ETHYLACETATE × 15 MYR MYRISTIC ACID × 15	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.80 Å
3IYB Poliovirus early RNA-release intermediate Deposited 2009-07-21	Different construct Different mutation/modification Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 300 PDB declaration: 300-meric	Chain 2 83–96（14 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 20mM Tris pH 7.4, 2mM CaCl2, 20mM NaCl；pH 7.4；20mM Tris pH 7.4, 2mM CaCl2, 20mM NaCl cryo-EM vitrification conditions blot for 3 secs；Cryogen ETHANE	Resolution 10.00 Å
3IYB Poliovirus early RNA-release intermediate Deposited 2009-07-21	Different construct Different mutation/modification Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain 2 83–96（14 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 20mM Tris pH 7.4, 2mM CaCl2, 20mM NaCl；pH 7.4；20mM Tris pH 7.4, 2mM CaCl2, 20mM NaCl cryo-EM vitrification conditions blot for 3 secs；Cryogen ETHANE	Resolution 10.00 Å
3IYB Poliovirus early RNA-release intermediate Deposited 2009-07-21	Different construct Different mutation/modification Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 25 PDB declaration: 25-meric	Chain 2 83–96（14 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 20mM Tris pH 7.4, 2mM CaCl2, 20mM NaCl；pH 7.4；20mM Tris pH 7.4, 2mM CaCl2, 20mM NaCl cryo-EM vitrification conditions blot for 3 secs；Cryogen ETHANE	Resolution 10.00 Å
3IYB Poliovirus early RNA-release intermediate Deposited 2009-07-21	Different construct Different mutation/modification Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain 2 83–96（14 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 20mM Tris pH 7.4, 2mM CaCl2, 20mM NaCl；pH 7.4；20mM Tris pH 7.4, 2mM CaCl2, 20mM NaCl cryo-EM vitrification conditions blot for 3 secs；Cryogen ETHANE	Resolution 10.00 Å
3IYB Poliovirus early RNA-release intermediate Deposited 2009-07-21	Different construct Different mutation/modification Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain 2 83–96（14 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 20mM Tris pH 7.4, 2mM CaCl2, 20mM NaCl；pH 7.4；20mM Tris pH 7.4, 2mM CaCl2, 20mM NaCl cryo-EM vitrification conditions blot for 3 secs；Cryogen ETHANE	Resolution 10.00 Å
3IYC Poliovirus late RNA-release intermediate Deposited 2009-07-21	Different construct Different mutation/modification Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 300 PDB declaration: 300-meric	Chain 2 83–96（14 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 20mM Tris pH 7.4, 2mM CaCl2, 20mM NaCl；pH 7.4；20mM Tris pH 7.4, 2mM CaCl2, 20mM NaCl cryo-EM vitrification conditions blot for 3 secs；Cryogen ETHANE	Resolution 10.00 Å
3IYC Poliovirus late RNA-release intermediate Deposited 2009-07-21	Different construct Different mutation/modification Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain 2 83–96（14 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 20mM Tris pH 7.4, 2mM CaCl2, 20mM NaCl；pH 7.4；20mM Tris pH 7.4, 2mM CaCl2, 20mM NaCl cryo-EM vitrification conditions blot for 3 secs；Cryogen ETHANE	Resolution 10.00 Å
3IYC Poliovirus late RNA-release intermediate Deposited 2009-07-21	Different construct Different mutation/modification Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 25 PDB declaration: 25-meric	Chain 2 83–96（14 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 20mM Tris pH 7.4, 2mM CaCl2, 20mM NaCl；pH 7.4；20mM Tris pH 7.4, 2mM CaCl2, 20mM NaCl cryo-EM vitrification conditions blot for 3 secs；Cryogen ETHANE	Resolution 10.00 Å
3IYC Poliovirus late RNA-release intermediate Deposited 2009-07-21	Different construct Different mutation/modification Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain 2 83–96（14 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 20mM Tris pH 7.4, 2mM CaCl2, 20mM NaCl；pH 7.4；20mM Tris pH 7.4, 2mM CaCl2, 20mM NaCl cryo-EM vitrification conditions blot for 3 secs；Cryogen ETHANE	Resolution 10.00 Å
3IYC Poliovirus late RNA-release intermediate Deposited 2009-07-21	Different construct Different mutation/modification Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain 2 83–96（14 aa）	Not recorded	No recorded non-water small molecule	ELECTRON MICROSCOPY cryo-EM buffer 20mM Tris pH 7.4, 2mM CaCl2, 20mM NaCl；pH 7.4；20mM Tris pH 7.4, 2mM CaCl2, 20mM NaCl cryo-EM vitrification conditions blot for 3 secs；Cryogen ETHANE	Resolution 10.00 Å
8E8R 9H2 Fab-Sabin poliovirus 3 complex Deposited 2022-08-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 360 PDB declaration: 360-meric	Chain 2 78–340（263 aa）	Not recorded	PLM PALMITIC ACID × 60	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.66 Å
8E8R 9H2 Fab-Sabin poliovirus 3 complex Deposited 2022-08-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain 2 78–340（263 aa）	Not recorded	PLM PALMITIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.66 Å
8E8R 9H2 Fab-Sabin poliovirus 3 complex Deposited 2022-08-25	Different construct Different mutation/modification Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain 2 78–340（263 aa）	Not recorded	PLM PALMITIC ACID × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.66 Å
8E8R 9H2 Fab-Sabin poliovirus 3 complex Deposited 2022-08-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 36 PDB declaration: 36-meric	Chain 2 78–340（263 aa）	Not recorded	PLM PALMITIC ACID × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.66 Å
8E8R 9H2 Fab-Sabin poliovirus 3 complex Deposited 2022-08-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain 2 78–340（263 aa）	Not recorded	PLM PALMITIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.66 Å
8E8X 9H2 Fab-Sabin poliovirus 3 complex Deposited 2022-08-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 360 PDB declaration: 360-meric	Chain 2 78–340（263 aa）	Not recorded	PLM PALMITIC ACID × 60	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
8E8X 9H2 Fab-Sabin poliovirus 3 complex Deposited 2022-08-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain 2 78–340（263 aa）	Not recorded	PLM PALMITIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
8E8X 9H2 Fab-Sabin poliovirus 3 complex Deposited 2022-08-26	Different construct Different mutation/modification Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain 2 78–340（263 aa）	Not recorded	PLM PALMITIC ACID × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
8E8X 9H2 Fab-Sabin poliovirus 3 complex Deposited 2022-08-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 36 PDB declaration: 36-meric	Chain 2 78–340（263 aa）	Not recorded	PLM PALMITIC ACID × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
8E8X 9H2 Fab-Sabin poliovirus 3 complex Deposited 2022-08-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain 2 78–340（263 aa）	Not recorded	PLM PALMITIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.91 Å
9OCO SIPV3-2E1 Complex Deposited 2025-04-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 360 PDB declaration: 360-meric	Chain 1 579–878（300 aa） Chain 2 70–340（271 aa） Chain 3 341–578（238 aa） Chain 4 2–69（68 aa）	Not recorded	PLM PALMITIC ACID × 60	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.95 Å
9OCO SIPV3-2E1 Complex Deposited 2025-04-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain 1 579–878（300 aa） Chain 2 70–340（271 aa） Chain 3 341–578（238 aa） Chain 4 2–69（68 aa）	Not recorded	PLM PALMITIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.95 Å
9OCO SIPV3-2E1 Complex Deposited 2025-04-24	Different construct Different mutation/modification Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 30 PDB declaration: 30-meric	Chain 1 579–878（300 aa） Chain 2 70–340（271 aa） Chain 3 341–578（238 aa） Chain 4 2–69（68 aa）	Not recorded	PLM PALMITIC ACID × 5	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.95 Å
9OCO SIPV3-2E1 Complex Deposited 2025-04-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 36 PDB declaration: 36-meric	Chain 1 579–878（300 aa） Chain 2 70–340（271 aa） Chain 3 341–578（238 aa） Chain 4 2–69（68 aa）	Not recorded	PLM PALMITIC ACID × 6	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.95 Å
9OCO SIPV3-2E1 Complex Deposited 2025-04-24	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain 1 579–878（300 aa） Chain 2 70–340（271 aa） Chain 3 341–578（238 aa） Chain 4 2–69（68 aa）	Not recorded	PLM PALMITIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.95 Å
9OD3 SIPV3-6B5 Complex Deposited 2025-04-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain 1 579–878（300 aa） Chain 2 70–340（271 aa） Chain 3 341–578（238 aa） Chain 4 2–69（68 aa）	Not recorded	PLM PALMITIC ACID × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.94 Å

11 other PDB entries and 56 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	POLG_POL3L
Isoform	—
PDB entities	3, 5
Chains and sequence ranges	Author chain 2； PDBConstruct 1–271； UniProt 70–340 Author chain 4； PDBConstruct 1–68； UniProt 2–69

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1pvc
Deposition date deposition_date	1995-03-30
Structure title title	REFINEMENT OF THE SABIN STRAIN OF TYPE 3 POLIOVIRUS AT 2.4 ANGSTROMS AND THE CRYSTAL STRUCTURES OF ITS VARIANTS AT 2.9 ANGSTROMS RESOLUTION
Keywords keywords	VIRUS, Icosahedral virus; VIRUS
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	30.05 Å
Radius of gyration Rg (electron density) rg_electron	29.05 Å
Forward intensity I(0) i0	141935000.00
Molecular weight molecular_weight	94482.0 kDa
Excluded volume excluded_volume	118230 Å³
Envelope volume envelope_volume	147860 Å³
Hydration-shell volume shell_volume	41285 Å³
Envelope diameter envelope_diameter	101.9 Å
Shell Rg shell_rg	37.11 Å
Envelope Rg envelope_rg	29.68 Å
Shape Rg shape_rg	29.03 Å
Total Rg total_rg	29.85 Å
Total atoms total_atoms	6652
Residues n_residues	846
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	97.0 Å
Rg (real space) rg_real	29.97 Å
Rg uncertainty (real space) rg_real_error	0.62 Å
I(0) (real space) i0_real	1.4190e+08
I(0) uncertainty (real space) i0_real_error	1.9160e+06
Rg (reciprocal space) rg_reciprocal	30.00 Å
I(0) (reciprocal space) i0_reciprocal	141900000.0000
Solution quality estimate total_estimate	0.8935
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	36.6 Å
Skewness Skewness skewness	0.288
Kurtosis Kurtosis kurtosis	-0.344
Angular range angular_range	— – 0.2650 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	27790000.0000
Real-space data points n_real_points	54
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.886; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.999; Smooth: 0.955

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Description description	POLIOVIRUS TYPE 3, SABIN STRAIN
Molecular weight formula_weight	446.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	0
Atom count atom_count	7075

ISEV

Entity 2 Entity 2 polymer

Description description	POLIOVIRUS TYPE 3, SABIN STRAIN
Molecular weight formula_weight	33651.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1

QGIEDLISEVAQGALTLSLPKQQDSLPDTKASGPAHSKEVPALTAVETGATNPLAPSDTVQTRHVVQRRSRSESTIESFFARGACVAIIEVDNEQPTTRAQKLFAMWRITYKDTVQLRRKLEFFTYSRFDMEFTFVVTANFTNANNGHALNQVYQIMYIPPGAPTPKSWDDYTWQTSSNPSIFYTYGAAPARISVPYVGLANAYSHFYDGFAKVPLKTDANDQIGDSLYSAMTVDDFGVLAVRVVNDHNPTKVTSKVRIYMKPKHVRVWCPRPPRAVPYYGPGVDYRNNLDPLSEKGLTTY

Entity 3 Entity 3 polymer

Description description	POLIOVIRUS TYPE 3, SABIN STRAIN
Molecular weight formula_weight	30169.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2

SPNVEACGYSDRVLQLTLGNSTITTQEAANSVVAYGRWPEFIRDDEANPVDQPTEPDVATCRFYTLDTVMWGKESKGWWWKLPDALRDMGLFGQNMYYHYLGRSGYTVHVQCNASKFHQGALGVFAIPEYCLAGDSDKQRYTSYANANPGERGGKFYSQFNKDNAVTSPKREFCPVDYLLGCGVLLGNAFVYPHQIINLRTNNSATIVLPYVNALAIDSMVKHNNWGIAILPLSPLDFAQDSSVEIPITVTIAPMCSEFNGLRNVTAPKFQ

Entity 4 Entity 4 polymer

Description description	POLIOVIRUS TYPE 3, SABIN STRAIN
Molecular weight formula_weight	26289.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

GLPVLNTPGSNQYLTSDNHQSPCAIPEFDVTPPIDIPGEVKNMMELAEIDTMIPLNLESTKRNTMDMYRVTLSDSADLSQPILCLSLSPAFDPRLSHTMLGEVLNYYTHWAGSLKFTFLFCGSMMATGKILVAYAPPGAQPPTSRKEAMLGTHVIWDLGLQSSCTMVVPWISNVTYRQTTQDSFTEGGYISMFYQTRIVVPLSTPKSMSMLGFVSACNDFSVRLLRDTTHISQSALPQ

Entity 5 Entity 5 polymer

Description description	POLIOVIRUS TYPE 3, SABIN STRAIN
Molecular weight formula_weight	7320.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4

GAQVSSQKVGAHENSNRAYGGSTINYTTINYYKDSASNAASKQDYSQDPSKFTEPLKDVLIKTAPALN

Entity 6 Entity 6 non-polymer

Description description	SPHINGOSINE
Molecular weight formula_weight	299.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 7 Entity 7 non-polymer

Description description	MYRISTIC ACID
Molecular weight formula_weight	228.4 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 8 Entity 8 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	423

▼

7. Fold Classification (SCOP + CATH) 7 domains

SCOP 2.08 (3 domains)

Domain ID domain_id	d1pvc.1
Class class	b — All beta proteins
Fold Fold fold	b.121 — Nucleoplasmin-like/VP (viral coat and capsid proteins)
Superfamily Superfamily superfamily	b.121.4 — Positive stranded ssRNA viruses
Family Family family	b.121.4.1 — Picornaviridae-like VP (VP1, VP2, VP3 and VP4)

Domain ID domain_id	d1pvc1_
Class class	b — All beta proteins
Fold Fold fold	b.121 — Nucleoplasmin-like/VP (viral coat and capsid proteins)
Superfamily Superfamily superfamily	b.121.4 — Positive stranded ssRNA viruses
Family Family family	b.121.4.1 — Picornaviridae-like VP (VP1, VP2, VP3 and VP4)

Domain ID domain_id	d1pvc3_
Class class	b — All beta proteins
Fold Fold fold	b.121 — Nucleoplasmin-like/VP (viral coat and capsid proteins)
Superfamily Superfamily superfamily	b.121.4 — Positive stranded ssRNA viruses
Family Family family	b.121.4.1 — Picornaviridae-like VP (VP1, VP2, VP3 and VP4)

CATH v4.4 (4 domains)

Domain ID domain_id	1pvc100
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	1pvc200
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	1pvc300
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	120 — Jelly Rolls
Homologous superfamily homologous superfamily	20 —

Domain ID domain_id	1pvc400
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	80 — Rhinovirus 14, subunit 4
Homologous superfamily homologous superfamily	10 — Picornavirus coat protein VP4

▶

8. Citations (8)

;Refinement of the Sabin Strain of Type 3 Poliovirus at 2.4 Angstroms and the Crystal Structures of its Variants at 2.9 Angstroms Resolution ;

To be Published

PRIMARY

Structural Determinants of Serotype Specificity Host Range and Thermostability in Poliovirus

Use of X-Ray Crystallography in the Design of Antiviral Agents (1990)

Role of Conformational Transitions in Poliovirus Assembly and Cell Entry

New Aspects of Positive-Strand RNA Viruses (1990)

Structural Factors that Control Conformational Transitions and Serotype Specificity in Type 3 Poliovirus

Embo J. (1989)

Structural Determinants of Serotype Specificity in Poliovirus

Vaccines 89: Modern Approaches to New Vaccines Including Prevention of Aids (1989)

Structural Determinants of Serotype Specificity and Host Range in Poliovirus

Concepts in Viral Pathogenesis III (1989)

Structural Basis for Serotypic Differences and Thermostability in Poliovirus

Molecular Aspects of Picornavirus Infection and Detection (1989)

The Nucleotide Sequence of Poliovirus Type 3 Leon 12A(1)B: Comparison with Poliovirus Type 1

Nucleic Acids Res. (1983)

▶

Unit-cell length a length_a	321.060 Å
Unit-cell length b length_b	358.620 Å
Unit-cell length c length_c	381.820 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	120

Space group space_group	I 2 2 2
Space-group number int_tables_number	23
Crystal system crystal_system	—

Resolution resolution	2.400 Å
Low-resolution limit resolution_low	10.000 Å
R factor r_factor	0.2050
R_work r_work	—
R_free r_free	—

fit	/app/data/saxs_computation/pv/1pvc/1pvc.fit
pddf	/app/data/pr_computation/pv/1pvc/1pvc.pr.out
profile	/app/data/saxs_computation/pv/1pvc/1pvc.dat

REFINEMENT OF THE SABIN STRAIN OF TYPE 3 POLIOVIRUS AT 2.4 ANGSTROMS AND THE CRYSTAL STRUCTURES OF ITS VARIANTS AT 2.9 ANGSTROMS RESOLUTION

1. Protein Identity and Related Structures Protein Identity & Related Structures

POLIOVIRUS TYPE 3, SABIN STRAIN

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

6. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 water

7. Fold Classification (SCOP + CATH) 7 domains

SCOP 2.08 (3 domains)

CATH v4.4 (4 domains)

8. Citations (8)

9. Files and Curves (10)

Files (7)

Curves (3)