1ry1

Structure of the signal recognition particle interacting with the elongation-arrested ribosome

Method: ELECTRON MICROSCOPY

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

SRP14

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 6 RNA 8	SRP Alu domain × 1 SRP S domain × 1 SRP RNA × 1 SRP RNA × 1 SRP RNA × 1 SRP RNA × 1 SRP RNA × 1 SRP RNA × 1 SRP9 × 1 SRP19 × 1 SRP54NG × 1 SRP54M × 1 signal sequence peptide × 1	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	SRP14_HUMAN
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain D； PDBConstruct 1–106； UniProt 2–107

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1ry1
Deposition date deposition_date	2003-12-19
Structure title title	Structure of the signal recognition particle interacting with the elongation-arrested ribosome
Keywords keywords	signal recognition particle, RNA binding, TRANSLATION; TRANSLATION
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1ry1__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1ry1__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1ry1__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	84.48 Å
Rg (electron density)	86.97 Å
Total Rg	86.89 Å
Atom count	11794
Residues	976
Excluded volume	187200 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1ry1__assembly_1__model_1`	tetradecameric （14）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (14)

Entity 1 Entity 1 polymer

Description description	SRP Alu domain
Molecular weight formula_weight	16277.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	E
Atom count atom_count	11794

GGGCCGGGCGCGGUGGCGCGCGCCUGUAGUCCCAGCUACUCGGGAGGCUC

Entity 2 Entity 2 polymer

Description description	SRP S domain
Molecular weight formula_weight	41566.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	A

GACACUAAGUUCGGCAUCAAUAUGGUGACCUCCCGGGAGCGGGGGACCACCAGGUUGCCUAAGGAGGGGUGAACCGGCCCAGGUCGGAAACGGAGCAGGUCAAAACUCCCGUGCUGAUCAGUAGUGUC

Entity 3 Entity 3 polymer

Description description	SRP RNA
Molecular weight formula_weight	8784.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	M

AGGCUGGAGGAUCGCUUGAGUCCAGGA

Entity 4 Entity 4 polymer

Description description	SRP RNA
Molecular weight formula_weight	9807.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	N

CCUGUGCAACAUAGCGAGACCCCGUCUCUUU

Entity 5 Entity 5 polymer

Description description	SRP RNA
Molecular weight formula_weight	7695.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	O

GUUCUGGGCUGUAGUGCGCUAUGC

Entity 6 Entity 6 polymer

Description description	SRP RNA
Molecular weight formula_weight	6325.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	P

CAAUAGCCACUGCACUCCAG

Entity 7 Entity 7 polymer

Description description	SRP RNA
Molecular weight formula_weight	3844.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	Q

CGAUCGGGUGUC

Entity 8 Entity 8 polymer

Description description	SRP RNA
Molecular weight formula_weight	3804.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	R

AUCGCGCCUGUG

Entity 9 Entity 9 polymer

Description description	SRP9
Molecular weight formula_weight	9996.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

PQYQTWEEFSRAAEKLYLADPMKARVVLKYRHSDGNLCVKVTDDLVCLVYKTDQAQDVKKIEKFHSQLMRLMVAKEARNVTMETE

Entity 10 Entity 10 polymer

Description description	SRP14
Molecular weight formula_weight	12114.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

VLLESEQFLTELTRLFQKCRTSGSVYITLKKYDGRTKPIPKKGTVEGFEPADNKCLLRATDGKKKISTVVSSKEVNKFQMAYSNLLRANMDGLKKRDKKNKTKKTK

Entity 11 Entity 11 polymer

Description description	SRP19
Molecular weight formula_weight	12561.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNVFLEKNKMYSREWNRDVQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYAAEMIPKLKTRTQ

Entity 12 Entity 12 polymer

Description description	SRP54NG
Molecular weight formula_weight	32472.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

MFQQLSARLQEAIGRLRGRGRITEEDLKATLREIRRALMDADVNLEVARDFVERVREEALGKQVLESLTPAEVILATVYEALKEALGGEARLPVLKDRNLWFLVGLQGSGKTTTAAKLALYYKGKGRRPLLVAADTQRPAAREQLRLLGEKVGVPVLEVMDGESPESIRRRVEEKARLEARDLILVDTAGRLQIDEPLMGELARLKEVLGPDEVLLVLDAMTGQEALSVARAFDEKVGVTGLVLTKLDGDARGGAALSARHVTGKPIYFAGVSEKPEGLEPFYPERLAGRILGMGD

Entity 13 Entity 13 polymer

Description description	SRP54M
Molecular weight formula_weight	12473.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W

QFTLRDMYEQFQNIMKMGPFSQILGMIPGFGTDFMSKGNEQESMARLKKLMTIMDSMNDQELDSTDGAKVFSKQPGRIQRVARGSGVSTRDVQELLTQYTKFAQMVKKM

Entity 14 Entity 14 polymer

Description description	signal sequence peptide
Molecular weight formula_weight	2121.5 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

LGFPINFLTLYVTVQHKK

▼

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (6 domains)

Domain ID domain_id	d1ry1b_
Class class	i — Low resolution protein structures
Fold Fold fold	i.22 — Signal recognition particle (SRP) complex
Superfamily Superfamily superfamily	i.22.1 — Signal recognition particle (SRP) complex
Family Family family	i.22.1.1 — Signal recognition particle (SRP) complex

Domain ID domain_id	d1ry1c_
Class class	i — Low resolution protein structures
Fold Fold fold	i.22 — Signal recognition particle (SRP) complex
Superfamily Superfamily superfamily	i.22.1 — Signal recognition particle (SRP) complex
Family Family family	i.22.1.1 — Signal recognition particle (SRP) complex

Domain ID domain_id	d1ry1d_
Class class	i — Low resolution protein structures
Fold Fold fold	i.22 — Signal recognition particle (SRP) complex
Superfamily Superfamily superfamily	i.22.1 — Signal recognition particle (SRP) complex
Family Family family	i.22.1.1 — Signal recognition particle (SRP) complex

Domain ID domain_id	d1ry1s_
Class class	i — Low resolution protein structures
Fold Fold fold	i.22 — Signal recognition particle (SRP) complex
Superfamily Superfamily superfamily	i.22.1 — Signal recognition particle (SRP) complex
Family Family family	i.22.1.1 — Signal recognition particle (SRP) complex

Domain ID domain_id	d1ry1u_
Class class	i — Low resolution protein structures
Fold Fold fold	i.22 — Signal recognition particle (SRP) complex
Superfamily Superfamily superfamily	i.22.1 — Signal recognition particle (SRP) complex
Family Family family	i.22.1.1 — Signal recognition particle (SRP) complex

Domain ID domain_id	d1ry1w_
Class class	i — Low resolution protein structures
Fold Fold fold	i.22 — Signal recognition particle (SRP) complex
Superfamily Superfamily superfamily	i.22.1 — Signal recognition particle (SRP) complex
Family Family family	i.22.1.1 — Signal recognition particle (SRP) complex

▶

Resolution resolution	12.000 Å
Low-resolution limit resolution_low	— Å
R factor r_factor	—
R_work r_work	—
R_free r_free	—

Resolution resolution	12.00 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	—

Structure of the signal recognition particle interacting with the elongation-arrested ribosome

1. Protein Identity and Related Structures Protein Identity & Related Structures

SRP14

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1ry1__assembly_1__model_1

1ry1__assembly_1__model_1 | I(q)

1ry1__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Refinement Refinement

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (14)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Entity 5 Entity 5 polymer

Polymer Polymer

Entity 6 Entity 6 polymer

Polymer Polymer

Entity 7 Entity 7 polymer

Polymer Polymer

Entity 8 Entity 8 polymer

Polymer Polymer

Entity 9 Entity 9 polymer

Polymer Polymer

Entity 10 Entity 10 polymer

Polymer Polymer

Entity 11 Entity 11 polymer

Polymer Polymer

Entity 12 Entity 12 polymer

Polymer Polymer

Entity 13 Entity 13 polymer

Polymer Polymer

Entity 14 Entity 14 polymer

Polymer Polymer

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (6 domains)

7. Citations (1)