1t0j

Crystal structure of a complex between voltage-gated calcium channel beta2a subunit and a peptide of the alpha1c subunit

Method: X-RAY DIFFRACTION D_max: 79.0 Å Quality: REASONABLE

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

voltage-gated calcium channel subunit beta2a

Rattus norvegicus

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain A； UniProt 17–145 Chain B； UniProt 203–425	Fragment：residues 17-145 Fragment：residues 203-425	Voltage-dependent L-type calcium channel alpha-1C subunit × 1 （Q13936） CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 8；277 K；Tris-Cl, PEG 4000, NaCl, pH 8, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.00 Å R-free 0.242
2	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain A； UniProt 17–145 Chain B； UniProt 203–425	Fragment：residues 17-145 Fragment：residues 203-425	Voltage-dependent L-type calcium channel alpha-1C subunit × 1 （Q13936） CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 8；277 K；Tris-Cl, PEG 4000, NaCl, pH 8, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.00 Å R-free 0.242

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 1T0J	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1T0H Crystal structure of the Rattus norvegicus voltage gated calcium channel beta subunit isoform 2a Deposited 2004-04-08	Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 17–145（129 aa） Fragment：residues 17-145 Chain B 203–425（223 aa） Fragment：residues 203-425	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；281 K；Tris-Cl, NaCl, PEG 4000, pH 8, VAPOR DIFFUSION, HANGING DROP, temperature 281K	Resolution 1.97 Å R-free 0.213
1T0H Crystal structure of the Rattus norvegicus voltage gated calcium channel beta subunit isoform 2a Deposited 2004-04-08	Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 17–145（129 aa） Fragment：residues 17-145 Chain B 203–425（223 aa） Fragment：residues 203-425	Non-standard monomer：Yes (specific site not provided by mmCIF) Non-standard monomer：Yes (specific site not provided by mmCIF)	CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；281 K；Tris-Cl, NaCl, PEG 4000, pH 8, VAPOR DIFFUSION, HANGING DROP, temperature 281K	Resolution 1.97 Å R-free 0.213
3JBR Cryo-EM structure of the rabbit voltage-gated calcium channel Cav1.1 complex at 4.2 angstrom Deposited 2015-09-29	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 68–196（129 aa） Chain B 254–475（222 aa）	Not recorded	CA CALCIUM ION × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 15 BMA beta-D-mannopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer 20mM MOPS, 200mM NaCl, 0.5mM CaCl2,0.1% digitonin；pH 7.4；20mM MOPS, 200mM NaCl, 0.5mM CaCl2,0.1% digitonin cryo-EM vitrification conditions Blot for 2 seconds before plunging；Cryogen ETHANE	Resolution 4.20 Å
5V2P CaV beta2a subunit: CaV1.2 AID-CAP complex Deposited 2017-03-06	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 24–145（122 aa） Fragment：beta2a subunit (UNP residues 24-145,254-476) Chain A 254–476（223 aa） Fragment：beta2a subunit (UNP residues 24-145,254-476)	Not recorded	NI NICKEL (II) ION × 1 1PE PENTAETHYLENE GLYCOL × 2 8VY 1,3-bis(bromomethyl)benzene × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.3；277 K；34-37% PEG400, 0.1 M magnesium chloride, 0.1 M MES, pH 6.3	Resolution 2.00 Å R-free 0.230
5V2Q CaV beta2a subunit: CaV1.2 AID-CEN complex Deposited 2017-03-06	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 68–189（122 aa） Fragment：beta2a subunit (UNP residues 68-189,203-425) Chain A 203–425（223 aa） Fragment：beta2a subunit (UNP residues 68-189,203-425)	Not recorded	CL CHLORIDE ION × 1 8VY 1,3-bis(bromomethyl)benzene × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；277 K；1.5-1.7 M ammonium sulfate, 5 mM BME, 0.1 M HEPES, pH 7.0	Resolution 1.70 Å R-free 0.196

4 other PDB entries and 5 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	CACB2_RAT
Isoform	—
PDB entities	1, 2
Chains and sequence ranges	Author chain A； PDBConstruct 4–132； UniProt 17–145 Author chain B； PDBConstruct 3–224； UniProt 203–425

Voltage-dependent L-type calcium channel alpha-1C subunit

Homo sapiens

UniProt Q13936

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain C； UniProt 428–445	Fragment：Residues 428-443	voltage-gated calcium channel subunit beta2a × 1 （Q8VGC3） voltage-gated calcium channel subunit beta2a × 1 （Q8VGC3） CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 8；277 K；Tris-Cl, PEG 4000, NaCl, pH 8, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.00 Å R-free 0.242
2	Protein heterocomplex Heteromer Protein × 3 PDB declaration: trimeric（3） Consistent with protein copy count	Chain C； UniProt 428–445	Fragment：Residues 428-443	voltage-gated calcium channel subunit beta2a × 1 （Q8VGC3） voltage-gated calcium channel subunit beta2a × 1 （Q8VGC3） CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 8；277 K；Tris-Cl, PEG 4000, NaCl, pH 8, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.00 Å R-free 0.242

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 1T0J	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2LQC NMR solution structure of a Ca2+-Calmodulin with a binding motif (NSCaTE) peptide from the N-terminal cytoplasmic domain of the L-type Voltage-Cated Calcium Channel alpha1C subunit Deposited 2012-02-29	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 47–68（22 aa） Fragment：UNP residues 47-68	Not recorded	CA CALCIUM ION × 2	SOLUTION NMR NMR measurement conditions pH 7；298 K；Ionic strength (raw mmCIF value) 100；Pressure ambient NMR sample composition 1 mM [U-100% 13C; U-100% 15N] calmodulin, 2 mM NSCaTE peptide, 55 M H2O, 5 M [U-99% 2H] D2O, 10 mM DTT, 20 mM TRIS, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 1 mM [U-100% 13C; U-100% 15N] NSCaTE peptide, 0.5 mM calmodulin, 55 M H2O, 5 M [U-99% 2H] D2O, 10 mM DTT, 20 mM TRIS, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 1 mM [U-100% 13C; U-100% 15N] calmodulin, 2 mM NSCaTE peptide, 7.5 mg Pf1 phage, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
3G43 Crystal structure of the calmodulin-bound Cav1.2 C-terminal regulatory domain dimer Deposited 2009-02-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain E 1609–1682（74 aa） Fragment：C-terminal fragment: UNP residues 1609-1682 Chain F 1609–1682（74 aa） Fragment：C-terminal fragment: UNP residues 1609-1682	Not recorded	CA CALCIUM ION × 14	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；298 K；20% PEG 6000, 1.0 M LiCl, 3% w/v MPD, 100 mM MES, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.10 Å R-free 0.269
3OXQ Crystal Structure of Ca2+/CaM-CaV1.2 pre-IQ/IQ domain complex Deposited 2010-09-21	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain E 1609–1685（77 aa） Fragment：preIQ/IQ domain (unp residues 1609-1685)	Not recorded	CA CALCIUM ION × 7	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；293 K；0.2 M Li2SO4, 24.5% PEG3350, 0.1 M Bis-Tris pH5.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.55 Å R-free 0.288
3OXQ Crystal Structure of Ca2+/CaM-CaV1.2 pre-IQ/IQ domain complex Deposited 2010-09-21	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain F 1609–1685（77 aa） Fragment：preIQ/IQ domain (unp residues 1609-1685)	Not recorded	CA CALCIUM ION × 7	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.5；293 K；0.2 M Li2SO4, 24.5% PEG3350, 0.1 M Bis-Tris pH5.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.55 Å R-free 0.288
5V2P CaV beta2a subunit: CaV1.2 AID-CAP complex Deposited 2017-03-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 427–445（19 aa） Fragment：AID-CAP (UNP residues 427-445)	Mutation：K427C, Q428S, Q429P, E432C	NI NICKEL (II) ION × 1 1PE PENTAETHYLENE GLYCOL × 2 8VY 1,3-bis(bromomethyl)benzene × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.3；277 K；34-37% PEG400, 0.1 M magnesium chloride, 0.1 M MES, pH 6.3	Resolution 2.00 Å R-free 0.230
5V2Q CaV beta2a subunit: CaV1.2 AID-CEN complex Deposited 2017-03-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 427–445（19 aa） Fragment：AID-CEN (UNP residues 427-445)	Mutation：K427A, Q428S, Q429P, K435C, D439C	CL CHLORIDE ION × 1 8VY 1,3-bis(bromomethyl)benzene × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7；277 K；1.5-1.7 M ammonium sulfate, 5 mM BME, 0.1 M HEPES, pH 7.0	Resolution 1.70 Å R-free 0.196
6C0A Actinin-1 EF-Hand bound to the Cav1.2 IQ Motif Deposited 2017-12-28	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1587–1609（23 aa） Fragment：IQ Motif (UNP residues 1587-1609)	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7.5；303 K；Ionic strength (raw mmCIF value) 0；Pressure 1 NMR sample composition 300 uM [U-99% 15N] Actinin-1 EF hand, 300 uM IQ Motif, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 300 uM [U-99% 15N] Cav1.2 IQ Motif, 300 uM Actinin-1 EF 3,3, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 300 uM [U-99% 13C; U-99% 15N] Actinin-1 EF 3,4, 300 uM Cav1.2 IQ Motif, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 12 mg/mL Pf1 phage, 300 uM [U-99% 15N] Actinin-1 EF 3,4, 300 uM Cav1.2 IQ Motif, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 12 mg/mL Pf1 phage, 300 uM [U-99% 15N] Cav1.2 IQ Motif, 300 uM Actinin-1 EF 3,4, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
6DAD 1.65 Angstrom crystal structure of the N97I Ca/CaM:CaV1.2 IQ domain complex Deposited 2018-05-01	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 1611–1644（34 aa） Fragment：UNP residues 1611-1644	Not recorded	CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；2.1 M sodium malonate, 0.1 M HEPES, pH 7.5	Resolution 1.65 Å R-free 0.208
6DAD 1.65 Angstrom crystal structure of the N97I Ca/CaM:CaV1.2 IQ domain complex Deposited 2018-05-01	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 1611–1644（34 aa） Fragment：UNP residues 1611-1644	Not recorded	CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；2.1 M sodium malonate, 0.1 M HEPES, pH 7.5	Resolution 1.65 Å R-free 0.208
6DAE 2.0 Angstrom crystal structure of the D95V Ca/CaM:CaV1.2 IQ domain complex Deposited 2018-05-01	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 1611–1644（34 aa） Fragment：UNP residues 1611-1644	Not recorded	CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 10.3；277 K；1 M lithium chloride, 30% PEG6000, 0.1M Bicine, pH 10.3	Resolution 2.00 Å R-free 0.226
6DAE 2.0 Angstrom crystal structure of the D95V Ca/CaM:CaV1.2 IQ domain complex Deposited 2018-05-01	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 1611–1644（34 aa） Fragment：UNP residues 1611-1644	Not recorded	CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 10.3；277 K；1 M lithium chloride, 30% PEG6000, 0.1M Bicine, pH 10.3	Resolution 2.00 Å R-free 0.226
6DAF 2.4 Angstrom crystal structure of the F141L Ca/CaM:CaV1.2 IQ domain complex Deposited 2018-05-01	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 1611–1644（34 aa） Fragment：UNP residues 1611-1644	Not recorded	CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；0.5 M potassium nitrate, 20% PEG3350	Resolution 2.40 Å R-free 0.243
6DAF 2.4 Angstrom crystal structure of the F141L Ca/CaM:CaV1.2 IQ domain complex Deposited 2018-05-01	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 1611–1644（34 aa） Fragment：UNP residues 1611-1644	Not recorded	CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；0.5 M potassium nitrate, 20% PEG3350	Resolution 2.40 Å R-free 0.243
6U39 2.4 Angstrom crystal structure of the D129G Ca-CaM:CaV1.2 IQ domain complex Deposited 2019-08-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1611–1644（34 aa）	Not recorded	CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；ammonium sulfate	Resolution 2.40 Å R-free 0.283
6U39 2.4 Angstrom crystal structure of the D129G Ca-CaM:CaV1.2 IQ domain complex Deposited 2019-08-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 10 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain T 1611–1644（34 aa）	Not recorded	CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；ammonium sulfate	Resolution 2.40 Å R-free 0.283
6U39 2.4 Angstrom crystal structure of the D129G Ca-CaM:CaV1.2 IQ domain complex Deposited 2019-08-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 1611–1644（34 aa）	Not recorded	CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；ammonium sulfate	Resolution 2.40 Å R-free 0.283
6U39 2.4 Angstrom crystal structure of the D129G Ca-CaM:CaV1.2 IQ domain complex Deposited 2019-08-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 1611–1644（34 aa）	Not recorded	CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；ammonium sulfate	Resolution 2.40 Å R-free 0.283
6U39 2.4 Angstrom crystal structure of the D129G Ca-CaM:CaV1.2 IQ domain complex Deposited 2019-08-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 1611–1644（34 aa）	Not recorded	CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；ammonium sulfate	Resolution 2.40 Å R-free 0.283
6U39 2.4 Angstrom crystal structure of the D129G Ca-CaM:CaV1.2 IQ domain complex Deposited 2019-08-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain J 1611–1644（34 aa）	Not recorded	CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；ammonium sulfate	Resolution 2.40 Å R-free 0.283
6U39 2.4 Angstrom crystal structure of the D129G Ca-CaM:CaV1.2 IQ domain complex Deposited 2019-08-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain L 1611–1644（34 aa）	Not recorded	CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；ammonium sulfate	Resolution 2.40 Å R-free 0.283
6U39 2.4 Angstrom crystal structure of the D129G Ca-CaM:CaV1.2 IQ domain complex Deposited 2019-08-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 7 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain N 1611–1644（34 aa）	Not recorded	CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；ammonium sulfate	Resolution 2.40 Å R-free 0.283
6U39 2.4 Angstrom crystal structure of the D129G Ca-CaM:CaV1.2 IQ domain complex Deposited 2019-08-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 8 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain P 1611–1644（34 aa）	Not recorded	CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；ammonium sulfate	Resolution 2.40 Å R-free 0.283
6U39 2.4 Angstrom crystal structure of the D129G Ca-CaM:CaV1.2 IQ domain complex Deposited 2019-08-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 9 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain R 1611–1644（34 aa）	Not recorded	CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；ammonium sulfate	Resolution 2.40 Å R-free 0.283
6U3A 1.65 Angstrom crystal structure of the N97S Ca-CaM:CaV1.2 IQ domain complex Deposited 2019-08-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 1611–1644（34 aa）	Not recorded	CA CALCIUM ION × 3 NA SODIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；DL-malic acid	Resolution 1.65 Å R-free 0.209
6U3A 1.65 Angstrom crystal structure of the N97S Ca-CaM:CaV1.2 IQ domain complex Deposited 2019-08-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 1611–1644（34 aa）	Not recorded	CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；277 K；DL-malic acid	Resolution 1.65 Å R-free 0.209
6U3B 1.7 Angstrom crystal structure of the Q135P Ca-CaM:CaV1.2 IQ domain complex Deposited 2019-08-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1611–1644（34 aa）	Not recorded	CA CALCIUM ION × 5	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；PEG 550 MME, sodium acetate	Resolution 1.70 Å R-free 0.200
6U3D 1.75 Angstrom crystal structure of the N53I Ca-CaM:CaV1.2 IQ domain complex Deposited 2019-08-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 1611–1644（34 aa）	Not recorded	CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；PEG 3350, citric acid	Resolution 1.75 Å R-free 0.201
6U3D 1.75 Angstrom crystal structure of the N53I Ca-CaM:CaV1.2 IQ domain complex Deposited 2019-08-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 1611–1644（34 aa）	Not recorded	CA CALCIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；PEG 3350, citric acid	Resolution 1.75 Å R-free 0.201
7L8V NMR Structure of half-calcified calmodulin mutant (CaMEF12) bound to the IQ-motif of CaV1.2 Deposited 2021-01-01	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 1662–1682（21 aa） Fragment：IQ-motif residues 1662-1682	Not recorded	CA CALCIUM ION × 2	SOLUTION NMR NMR measurement conditions pH 7.4；303 K；Ionic strength (raw mmCIF value) 0.1；Pressure 1 NMR sample composition 0.5 mM [U-95% 15N] calmodulin, 0.75 mM IQ-motif, 10 mM TRIS, 2 mM CALCIUM ION, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 0.5 mM [U-13C; U-15N] calmodulin, 0.75 mM IQ-motif, 10 mM TRIS, 2 mM CALCIUM ION, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
8EOI Structure of a human EMC:human Cav1.2 channel complex in GDN detergent Deposited 2022-10-03	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 11 PDB declaration: undecameric	Chain K 109–1658（1550 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 9Z9 (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.40 Å
8FD7 Structure of the human L-type voltage-gated calcium channel Cav1.2 complexed with gabapentin Deposited 2022-12-02	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain K 1–1648（1648 aa）	Not recorded	NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 8 GBN [1-(AMINOMETHYL)CYCLOHEXYL]ACETIC ACID × 1 CA CALCIUM ION × 3 NA SODIUM ION × 1 WO9 (2R)-3-{[(R)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(dodecanoyloxy)propyl heptadecanoate × 1 YSW (2S)-3-{[(R)-(2-aminoethoxy)(hydroxy)phosphoryl]oxy}-2-(dodecanoyloxy)propyl dodecanoate × 1 CLR CHOLESTEROL × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 8 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.10 Å
8FHS Human L-type voltage-gated calcium channel Cav1.2 in the presence of amiodarone and sofosbuvir at 3.3 Angstrom resolution Deposited 2022-12-15	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1–2221（2221 aa）	Not recorded	CA CALCIUM ION × 2 BBI (2-butyl-1-benzofuran-3-yl){4-[2-(diethylamino)ethoxy]-3,5-diiodophenyl}methanone × 1 WG6 Sofosbuvir × 1 3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 2 CLR CHOLESTEROL × 4 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.30 Å
8WE6 Human L-type voltage-gated calcium channel Cav1.2 at 2.9 Angstrom resolution Deposited 2023-09-17	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1–2201（2201 aa）	Not recorded	CA CALCIUM ION × 2 3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 1 CLR CHOLESTEROL × 4 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3 PT5 [(2R)-1-octadecanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phospho ryl]oxy-propan-2-yl] (8Z)-icosa-5,8,11,14-tetraenoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
8WE7 Human L-type voltage-gated calcium channel Cav1.2 in the presence of calciseptine at 3.2 Angstrom resolution Deposited 2023-09-17	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–2201（2201 aa）	Not recorded	CA CALCIUM ION × 2 CLR CHOLESTEROL × 2 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
8WE8 Human L-type voltage-gated calcium channel Cav1.2 in the presence of calciseptine, amlodipine and pinaverium at 2.9 Angstrom resolution Deposited 2023-09-17	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–2201（2201 aa）	Not recorded	CA CALCIUM ION × 2 CLR CHOLESTEROL × 5 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3 PT5 [(2R)-1-octadecanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phospho ryl]oxy-propan-2-yl] (8Z)-icosa-5,8,11,14-tetraenoate × 1 3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 1 6UB amlodipine × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 2.90 Å
8WE9 Human L-type voltage-gated calcium channel Cav1.2 (Class I) in the presence of pinaverium at 3.0 Angstrom resolution Deposited 2023-09-17	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1–2201（2201 aa）	Not recorded	CA CALCIUM ION × 2 3PE 1,2-Distearoyl-sn-glycerophosphoethanolamine × 1 CLR CHOLESTEROL × 3 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 3 PT5 [(2R)-1-octadecanoyloxy-3-[oxidanyl-[(1R,2R,3S,4R,5R,6S)-2,3,6-tris(oxidanyl)-4,5-diphosphonooxy-cyclohexyl]oxy-phospho ryl]oxy-propan-2-yl] (8Z)-icosa-5,8,11,14-tetraenoate × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.00 Å
8WEA Human L-type voltage-gated calcium channel Cav1.2 (Class II) in the presence of pinaverium at 3.2 Angstrom resolution Deposited 2023-09-17	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–2201（2201 aa）	Not recorded	CA CALCIUM ION × 2 9Z9 (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en × 1 WB9 4-[(2-bromanyl-4,5-dimethoxy-phenyl)methyl]-4-[2-[2-[(1~{R},2~{S},5~{R})-6,6-dimethyl-2-bicyclo[3.1.1]heptanyl]ethoxy]ethyl]morpholin-4-ium × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 2	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.20 Å
9ZZ4 NMR structure of CaBP1 bound to the IQ motif of Cav1.2 Deposited 2026-01-06	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1587–1609（23 aa） Fragment：IQ Motif (UNP residues 1587-1609)	Not recorded	CA CALCIUM ION × 2	SOLUTION NMR NMR measurement conditions pH 7.5；300 K；Ionic strength (raw mmCIF value) 10；Pressure 1 NMR sample composition 0.5 mM [U-100% 15N] CaBP1 C-Lobe, 0.75 mM CaV1.2 IQ motif, 1 mM Ca2+, 10 mM [U-100% 2H] Tris, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 0.6 mM [U-100% 13C; U-100% 15N] CaBP1 C-Lobe, 0.9 mM CaV1.2 IQ motif, 1 mM Ca2+, 10 mM [U-100% 2H] Tris, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided

23 other PDB entries and 38 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	CAC1C_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 3–20； UniProt 428–445

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1t0j
Deposition date deposition_date	2004-04-09
Structure title title	Crystal structure of a complex between voltage-gated calcium channel beta2a subunit and a peptide of the alpha1c subunit
Keywords keywords	SH3 domain, nucleotide kinase like domain, ion channel, calcium channel, AID, SIGNALING PROTEIN; SIGNALING PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	23.61 Å
Radius of gyration Rg (electron density) rg_electron	22.52 Å
Forward intensity I(0) i0	19365300.00
Molecular weight molecular_weight	33632.0 kDa
Excluded volume excluded_volume	42282 Å³
Envelope volume envelope_volume	52592 Å³
Hydration-shell volume shell_volume	20394 Å³
Envelope diameter envelope_diameter	82.6 Å
Shell Rg shell_rg	28.42 Å
Envelope Rg envelope_rg	23.04 Å
Shape Rg shape_rg	22.49 Å
Total Rg total_rg	23.43 Å
Total atoms total_atoms	2368
Residues n_residues	299
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	79.0 Å
Rg (real space) rg_real	23.70 Å
Rg uncertainty (real space) rg_real_error	0.64 Å
I(0) (real space) i0_real	1.9370e+07
I(0) uncertainty (real space) i0_real_error	2.6330e+05
Rg (reciprocal space) rg_reciprocal	23.68 Å
I(0) (reciprocal space) i0_reciprocal	19370000.0000
Solution quality estimate total_estimate	0.6263
Solution quality rating solution_quality	REASONABLE a REASONABLE solution
P(r) peaks n_peaks	3
Primary peak position r_peak_primary	22.2 Å
Skewness Skewness skewness	0.432
Kurtosis Kurtosis kurtosis	-0.323
Angular range angular_range	— – 0.3350 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	4809000.0000
Real-space data points n_real_points	65
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.801; Stabil: 0.991; Sysdev: 0.286; Positv: 1.000; Valcen: 0.904; Smooth: 0.000

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	voltage-gated calcium channel subunit beta2a
Molecular weight formula_weight	14996.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	2506

GHMGSADSYTSRPSDSDVSLEEDREAVRREAERQAQAQLEKAKTKPVAFAVRTNVRYSAAQEDDVPVPGMAISFEAKDFLHVKEKFNNDWWIGRLVKEGCEIGFIPSPVKLENMRLQHEQRAKQGKFYSSKS

来源 Source

来源生物 organism	Rattus norvegicus
通用名 common_name	Norway rat
NCBI Class编号 ncbi_taxonomy_id	10116
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	voltage-gated calcium channel subunit beta2a
Molecular weight formula_weight	25321.3 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MSKEKRMPFFKKTEHTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRISITRVTADISLAKRSVLNNPSKHAIIERSNTRSSLAEVQSEIERIFELARTLQLVVLDADTINHPAQLSKTSLAPIIVYVKISSPKVLQRLIKSRGKSQAKHLNVQMVAADKLAQCPPQESFDVILDENQLEDACEHLADYLEAYWKATHPPSSNLPNPLLSRT

来源 Source

来源生物 organism	Rattus norvegicus
通用名 common_name	Norway rat
NCBI Class编号 ncbi_taxonomy_id	10116
宿主生物 host_organism	Escherichia coli

Entity 3 Entity 3 polymer

Description description	Voltage-dependent L-type calcium channel alpha-1C subunit
Molecular weight formula_weight	2308.5 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

GAQQLEEDLKGYLDWITQAE

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 4 Entity 4 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	138

▼

7. Fold Classification (SCOP + CATH) 5 domains

SCOP 2.08 (3 domains)

Domain ID domain_id	d1t0ja_
Class class	b — All beta proteins
Fold Fold fold	b.34 — SH3-like barrel
Superfamily Superfamily superfamily	b.34.2 — SH3-domain
Family Family family	b.34.2.1 — SH3-domain

Domain ID domain_id	d1t0jb_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.37 — P-loop containing nucleoside triphosphate hydrolases
Superfamily Superfamily superfamily	c.37.1 — P-loop containing nucleoside triphosphate hydrolases
Family Family family	c.37.1.1 — Nucleotide and nucleoside kinases

Domain ID domain_id	d1t0jc_
Class class	j — Peptides
Fold Fold fold	j.68 — Fragments of the L-type calcium channel alpha subunit Cav.1 (dihydropyridine receptor)
Superfamily Superfamily superfamily	j.68.1 — Fragments of the L-type calcium channel alpha subunit Cav.1 (dihydropyridine receptor)
Family Family family	j.68.1.1 — Fragments of the L-type calcium channel alpha subunit Cav.1 (dihydropyridine receptor)

CATH v4.4 (2 domains)

Domain ID domain_id	1t0jA00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	40 — SH3 Domains

Domain ID domain_id	1t0jB00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

▶

8. Citations (1)

▶

Unit-cell length a length_a	36.756 Å
Unit-cell length b length_b	45.330 Å
Unit-cell length c length_c	60.652 Å
Unit-cell angle α angle_alpha	96.81 °
Unit-cell angle β angle_beta	102.46 °
Unit-cell angle γ angle_gamma	98.53 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.000 Å
Low-resolution limit resolution_low	30.000 Å
R factor r_factor	0.2019
R_work r_work	0.1997
R_free r_free	0.2415

fit	/app/data/saxs_computation/t0/1t0j/1t0j.fit
pddf	/app/data/pr_computation/t0/1t0j/1t0j.pr.out
profile	/app/data/saxs_computation/t0/1t0j/1t0j.dat

Crystal structure of a complex between voltage-gated calcium channel beta2a subunit and a peptide of the alpha1c subunit

1. Protein Identity and Related Structures Protein Identity & Related Structures

voltage-gated calcium channel subunit beta2a

State in the Current Structure

Other States of the Same Protein in the Database

Voltage-dependent L-type calcium channel alpha-1C subunit

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 polymer

Polymer Polymer

来源 Source

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

7. Fold Classification (SCOP + CATH) 5 domains

SCOP 2.08 (3 domains)

CATH v4.4 (2 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)