SAXSdb — 1wtr

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA-binding proteins 7a/7b/7d

Sulfolobus acidocaldarius

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein–DNA Monomer Protein × 1 DNA 2 PDB declaration: trimeric（3） Consistent with all polymer counts	Chain A； UniProt 0–65	Mutation：M29A	5'-D(GPCPGPAPTPCPGPC)-3' × 2	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；PEG 400, Tris buffer , pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 298.0K	Resolution 1.80 Å R-free 0.274

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 1WTR	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1AZP HYPERTHERMOPHILE CHROMOSOMAL PROTEIN SAC7D BOUND WITH KINKED DNA DUPLEX Deposited 1997-11-19	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Monomer；Protein × 1 PDB declaration: trimeric	Chain A 1–65（65 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；pH 6.5, VAPOR DIFFUSION, HANGING DROP	Resolution 1.60 Å R-free 0.252
1AZQ HYPERTHERMOPHILE CHROMOSOMAL PROTEIN SAC7D BOUND WITH KINKED DNA DUPLEX Deposited 1997-11-20	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Monomer；Protein × 1 PDB declaration: trimeric	Chain A 1–65（65 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；pH 6.5, VAPOR DIFFUSION, HANGING DROP	Resolution 1.94 Å R-free 0.238
1BF4 CHROMOSOMAL DNA-BINDING PROTEIN SSO7D/D(GCGAACGC) COMPLEX Deposited 1998-05-27	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Monomer；Protein × 1 PDB declaration: trimeric	Chain A 1–63（63 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.5；pH 6.5	Resolution 1.60 Å R-free 0.288
1CA5 INTERCALATION SITE OF HYPERTHERMOPHILE CHROMOSOMAL PROTEIN SSO7D/SAC7D BOUND TO DNA Deposited 1999-02-23	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Monomer；Protein × 1 PDB declaration: trimeric	Chain A 1–65（65 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；pH 6.5, VAPOR DIFFUSION, HANGING DROP	Resolution 2.20 Å R-free 0.276
1CA6 INTERCALATION SITE OF HYPERTHERMOPHILE CHROMOSOMAL PROTEIN SSO7D/SAC7D BOUND TO DNA Deposited 1999-02-23	Different construct Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Monomer；Protein × 1 PDB declaration: trimeric	Chain A 1–65（65 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；pH 6.5, VAPOR DIFFUSION, HANGING DROP	Resolution 2.20 Å R-free 0.257
1SAP HYPERTHERMOPHILE PROTEIN, RELAXATION MATRIX REFINEMENT STRUCTURE Deposited 1995-04-25	Different construct Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–65（65 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR mmCIF provides none of the parsed conditions	Resolution not provided
1WD0 Crystal structures of the hyperthermophilic chromosomal protein Sac7d in complex with DNA decamers Deposited 2004-05-10	Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Monomer；Protein × 1 PDB declaration: trimeric	Chain A 0–65（66 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；Tris-HCl, PEG400, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.90 Å R-free 0.257
1WD1 Crystal structures of the hyperthermophilic chromosomal protein Sac7d in complex with DNA decamers Deposited 2004-05-10	Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Monomer；Protein × 1 PDB declaration: trimeric	Chain A 0–65（66 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 4；298 K；potassium phosphate, PEG8000, pH 4, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.20 Å R-free 0.290
1WTO Hyperthermophile chromosomal protein SAC7D double mutant V26F/M29F in complex with DNA GCGATCGC Deposited 2004-11-29	Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Monomer；Protein × 1 PDB declaration: trimeric	Chain A 0–65（66 aa）	Mutation：V26F/M29F	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；PEG 400, Tris buffer, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 298.0K	Resolution 1.50 Å R-free 0.231
1WTP Hyperthermophile chromosomal protein SAC7D single mutant M29F in complex with DNA GCGA(UBr)CGC Deposited 2004-11-29	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 2 PDB declaration: hexameric	Chain A 0–65（66 aa） Chain B 0–65（66 aa）	Mutation：M29F Mutation：M29F	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；PEG 400, Tris buffer, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 298.0K	Resolution 1.90 Å R-free 0.287
1WTQ Hyperthermophile chromosomal protein SAC7D single mutant M29F in complex with DNA GTAATTAC Deposited 2004-11-29	Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Monomer；Protein × 1 PDB declaration: trimeric	Chain A 0–65（66 aa）	Mutation：M29F	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；PEG 400, Tris buffer, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 298.0K	Resolution 1.70 Å R-free 0.225
1WTV Hyperthermophile chromosomal protein SAC7D single mutant M29A in complex with DNA GTAATTAC Deposited 2004-11-29	Different structure-quality metrics	Assembly 1 Protein–DNA Monomer；Protein × 1 PDB declaration: trimeric	Chain A 0–65（66 aa）	Mutation：M29A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；PEG 400, Tris buffer , pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 298.0K	Resolution 1.60 Å R-free 0.238
1WTW Hyperthermophile chromosomal protein SAC7D single mutant V26A in complex with DNA GCGATCGC Deposited 2004-11-29	Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Monomer；Protein × 1 PDB declaration: trimeric	Chain A 0–65（66 aa）	Mutation：V26A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；PEG 400, Tris buffer, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 298.0K	Resolution 2.20 Å R-free 0.286
1WTX Hyperthermophile chromosomal protein SAC7D single mutant V26A in complex with DNA GTAATTAC Deposited 2004-11-29	Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Monomer；Protein × 1 PDB declaration: trimeric	Chain A 0–65（66 aa）	Mutation：V26A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；298 K；PEG 400, Tris buffer, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 298.0K	Resolution 2.20 Å R-free 0.253
1WVL Crystal Structure of Multimeric DNA-binding Protein Sac7d-GCN4 with DNA decamer Deposited 2004-12-16	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Homooligomer；Protein × 4 PDB declaration: octameric	Chain not uniquely mapped Reference range not declared Chain A 0–65（66 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；298 K；1.6M Tri-Sodium Citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.60 Å R-free 0.269
1XX8 NMR Structure of the W24A Mutant of the Hyperthermophile Sac7d Protein Deposited 2004-11-04	Different mutation/modification Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 0–65（66 aa）	Mutation：W24A	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 4.5；303 K；Pressure ambient NMR sample composition 5 mM Sac7d, 90% H2O, 10% D2O \| 90% H2O/10% D2O	Resolution not provided
1XYI Hyperthermophile chromosomal protein Sac7d double mutant Val26Ala/Met29Ala in complex with DNA GCGATCGC Deposited 2004-11-10	Different mutation/modification Different experimental conditions Different structure-quality metrics	Assembly 1 Protein–DNA Monomer；Protein × 1 PDB declaration: trimeric	Chain A 0–65（66 aa）	Mutation：V26A, M29A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.4；298 K；Tris, PEG400, pH 7.4, VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 1.45 Å R-free 0.255
2XIW Crystal structure of the Sac7d-derived IgG1-binder C3-C24S Deposited 2010-07-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 2–66（65 aa） Chain B 2–66（65 aa）	Mutation：YES Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：YES Non-standard monomer：Yes (specific site not provided by mmCIF)	SO4 SULFATE ION × 4 CL CHLORIDE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions 3.5 M (NH4)2SO4	Resolution 1.50 Å R-free 0.191
8CMN 18mer DNA mimic Foldamer with an aliphatic linker in complex with Sac7d wild protein Deposited 2023-02-20	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: monomeric	Chain AA 1–66（66 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；293.15 K；10% PEG 400, 0.1 M MES pH 6.0	Resolution 2.65 Å R-free 0.297
8Q2M 18mer DNA mimic Foldamer with an Aliphatic linker in complex with Sac7d V26A/M29A protein Deposited 2023-08-02	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain AA 1–66（66 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；293 K；9 % PEG 400, 0.1 M MES pH 6.0	Resolution 3.21 Å R-free 0.335
8QPC 18mer DNA mimic Foldamer with an Aromatic linker in complex with Sac7d V26A/M29A protein Deposited 2023-10-01	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: monomeric	Chain AA 1–66（66 aa）	Mutation：V26A/M29A	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；293.15 K；10 % PEG 400, 0.1 M MES pH 6.0	Resolution 3.24 Å R-free 0.348
9HIZ Complex of the Nanofitin Sac7d-C3(C24A) with a human IgG1 Fc fragment Deposited 2024-11-27	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain R 2–66（65 aa） Chain S 2–66（65 aa） Chain T 2–66（65 aa） Chain U 2–66（65 aa）	Mutation：K7L,Y8L,K9N,K21R,K22D,W24A,V26Q,M29N,S31K,T33L,D35N,T40Y,R42A,A44N,S46D Mutation：K7L,Y8L,K9N,K21R,K22D,W24A,V26Q,M29N,S31K,T33L,D35N,T40Y,R42A,A44N,S46D Mutation：K7L,Y8L,K9N,K21R,K22D,W24A,V26Q,M29N,S31K,T33L,D35N,T40Y,R42A,A44N,S46D Mutation：K7L,Y8L,K9N,K21R,K22D,W24A,V26Q,M29N,S31K,T33L,D35N,T40Y,R42A,A44N,S46D	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.5；293 K；24 % (w/v) PEG8000, 0.1 M Tris/HCl pH 8.5	Resolution 2.90 Å R-free 0.279
9QT7 Crystal structure of affitin C10 fused to a coiled-coil domain in complex with a quinoline oligoamide foldamer Deposited 2025-04-08	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 2–65（64 aa） Chain B 2–65（64 aa） Chain C 2–65（64 aa） Chain D 2–65（64 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；20% PEG 400 0.1M Sodium cacodylate pH 6.5	Resolution 2.80 Å R-free 0.296
9QT7 Crystal structure of affitin C10 fused to a coiled-coil domain in complex with a quinoline oligoamide foldamer Deposited 2025-04-08	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 2 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 2–65（64 aa） Chain D 2–65（64 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；20% PEG 400 0.1M Sodium cacodylate pH 6.5	Resolution 2.80 Å R-free 0.296
9QT7 Crystal structure of affitin C10 fused to a coiled-coil domain in complex with a quinoline oligoamide foldamer Deposited 2025-04-08	Different construct Different mutation/modification Different oligomeric state Different experimental conditions Different structure-quality metrics	Assembly 3 Insufficient information Homooligomer；Protein × 2 PDB declaration: dimeric	Chain B 2–65（64 aa） Chain C 2–65（64 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；20% PEG 400 0.1M Sodium cacodylate pH 6.5	Resolution 2.80 Å R-free 0.296

23 other PDB entries and 25 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	DN71_SULAC
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain A； PDBConstruct 1–66； UniProt 0–65

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1wtr
Deposition date deposition_date	2004-11-29
Structure title title	Hyperthermophile chromosomal protein SAC7D single mutant M29A in complex with DNA GCGATCGC
Keywords keywords	;COMPLEX CHROMATIN PROTEIN-DNA, MINOR-GROOVE DNA BINDING, ARCHEA, KINKED-DNA, INTERCALATION, Sac7d mutant, DNA BINDING PROTEIN-DNA COMPLEX ;; DNA BINDING PROTEIN/DNA
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	14.44 Å
Radius of gyration Rg (electron density) rg_electron	13.45 Å
Forward intensity I(0) i0	4612670.00
Molecular weight molecular_weight	12388.0 kDa
Excluded volume excluded_volume	14231 Å³
Envelope volume envelope_volume	16791 Å³
Hydration-shell volume shell_volume	10838 Å³
Envelope diameter envelope_diameter	45.6 Å
Shell Rg shell_rg	18.95 Å
Envelope Rg envelope_rg	13.92 Å
Shape Rg shape_rg	13.35 Å
Total Rg total_rg	14.66 Å
Total atoms total_atoms	852
Residues n_residues	82
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	46.9 Å
Rg (real space) rg_real	14.37 Å
Rg uncertainty (real space) rg_real_error	0.34 Å
I(0) (real space) i0_real	4.6130e+06
I(0) uncertainty (real space) i0_real_error	5.6750e+04
Rg (reciprocal space) rg_reciprocal	14.37 Å
I(0) (reciprocal space) i0_reciprocal	4613000.0000
Solution quality estimate total_estimate	0.8892
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	18.4 Å
Skewness Skewness skewness	0.198
Kurtosis Kurtosis kurtosis	-0.342
Angular range angular_range	— – 0.5000 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	482800.0000
Real-space data points n_real_points	80
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.859; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 1.000; Smooth: 0.979

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	5'-D(GPCPGPAPTPCPGPC)-3'
Molecular weight formula_weight	2427.6 kDa
Source method src_method	syn
Copy count entity_count	2

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	B,C
Atom count atom_count	996

GCGATCGC

Entity 2 Entity 2 polymer

Description description	DNA-binding proteins 7a/7b/7d
Molecular weight formula_weight	7566.8 kDa
Mutation mutation	M29A
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MVKVKFKYKGEEKEVDTSKIKKVWRVGKAVSFTYDDNGKTGRGAVSEKDAPKELLDMLARAEREKK

来源 Source

来源生物 organism	Sulfolobus acidocaldarius
NCBI Class编号 ncbi_taxonomy_id	2285
宿主生物 host_organism	Escherichia coli

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	144

▼

7. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (1 domains)

Domain ID domain_id	d1wtra_
Class class	b — All beta proteins
Fold Fold fold	b.34 — SH3-like barrel
Superfamily Superfamily superfamily	b.34.13 — Chromo domain-like
Family Family family	b.34.13.1 — Histone-like proteins from archaea

CATH v4.4 (1 domains)

Domain ID domain_id	1wtrA00
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	50 — OB fold (Dihydrolipoamide Acetyltransferase, E2P)
Homologous superfamily homologous superfamily	40 —

▶

8. Citations (1)

▶

Unit-cell length a length_a	34.506 Å
Unit-cell length b length_b	49.512 Å
Unit-cell length c length_c	76.569 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	1.800 Å
Low-resolution limit resolution_low	20.000 Å
R factor r_factor	0.2322
R_work r_work	0.2270
R_free r_free	0.2740

fit	/app/data/saxs_computation/wt/1wtr/1wtr.fit
pddf	/app/data/pr_computation/wt/1wtr/1wtr.pr.out
profile	/app/data/saxs_computation/wt/1wtr/1wtr.dat

Hyperthermophile chromosomal protein SAC7D single mutant M29A in complex with DNA GCGATCGC

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA-binding proteins 7a/7b/7d

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 water

7. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (1 domains)

CATH v4.4 (1 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)