SAXSdb — 1wtv

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA-binding proteins 7a/7b/7d

Sulfolobus acidocaldarius

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–DNA	Monomer	Protein 1 DNA 2	5'-D(GPTPAPAPTPTPAPC)-3' × 2 water × 3	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	DN71_SULAC
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain A； PDBConstruct 1–66； UniProt 0–65

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1wtv
Deposition date deposition_date	2004-11-29
Structure title title	Hyperthermophile chromosomal protein SAC7D single mutant M29A in complex with DNA GTAATTAC
Keywords keywords	;COMPLEX CHROMATIN PROTEIN-DNA, MINOR-GROOVE DNA BINDING, ARCHEA, KINKED-DNA, INTERCALATION, Sac7d mutant, DNA BINDING PROTEIN-DNA COMPLEX ;; DNA BINDING PROTEIN/DNA
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1wtv__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1wtv__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1wtv__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	14.44 Å
Rg (electron density)	13.36 Å
Total Rg	14.54 Å
Atom count	834
Residues	80
Excluded volume	13955 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1wtv__assembly_1__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	5'-D(GPTPAPAPTPTPAPC)-3'
Molecular weight formula_weight	2425.6 kDa
Source method src_method	syn
Copy count entity_count	2

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	B,C
Atom count atom_count	973

GTAATTAC

Entity 2 Entity 2 polymer

Description description	DNA-binding proteins 7a/7b/7d
Molecular weight formula_weight	7566.8 kDa
Mutation mutation	M29A
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MVKVKFKYKGEEKEVDTSKIKKVWRVGKAVSFTYDDNGKTGRGAVSEKDAPKELLDMLARAEREKK

Source Source

Source organism organism	Sulfolobus acidocaldarius
NCBI taxonomy ID ncbi_taxonomy_id	2285
Host organism host_organism	Escherichia coli

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	139

▼

6. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (1 domains)

Domain ID domain_id	d1wtva_
Class class	b — All beta proteins
Fold Fold fold	b.34 — SH3-like barrel
Superfamily Superfamily superfamily	b.34.13 — Chromo domain-like
Family Family family	b.34.13.1 — Histone-like proteins from archaea

CATH v4.4 (1 domains)

Domain ID domain_id	1wtvA00
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	50 — OB fold (Dihydrolipoamide Acetyltransferase, E2P)
Homologous superfamily homologous superfamily	40 —

▶

Unit-cell length a length_a	35.923 Å
Unit-cell length b length_b	47.968 Å
Unit-cell length c length_c	77.777 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	1.600 Å
Low-resolution limit resolution_low	30.000 Å
R factor r_factor	0.2132
R_work r_work	0.2100
R_free r_free	0.2380

Hyperthermophile chromosomal protein SAC7D single mutant M29A in complex with DNA GTAATTAC

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA-binding proteins 7a/7b/7d

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1wtv__assembly_1__model_1

1wtv__assembly_1__model_1 | I(q)

1wtv__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (1 domains)

CATH v4.4 (1 domains)

7. Citations (1)

Hyperthermophile chromosomal protein SAC7D single mutant M29A in complex with DNA GTAATTAC

1. Protein Identity and Related Structures Protein Identity & Related Structures

DNA-binding proteins 7a/7b/7d

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1wtv__assembly_1__model_1

1wtv__assembly_1__model_1 | I(q)

1wtv__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (1 domains)

CATH v4.4 (1 domains)

7. Citations (1)