SAXSdb — 1yem

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Conserved hypothetical protein Pfu-838710-001

Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 2	PLATINUM (II) ION × 1 UNKNOWN ATOM OR ION × 7 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q8U2H2_PYRFU
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 10–179； UniProt 2–171 Author chain B； PDBConstruct 10–179； UniProt 2–171

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1yem
Deposition date deposition_date	2004-12-28
Structure title title	Conserved hypothetical protein Pfu-838710-001 from Pyrococcus furiosus
Keywords keywords	;Structural Genomics, Southeast Collaboratory for Structural Genomics, SECSG, Protein Structure Initiative, PSI, conserved hypothetical protein, Pyrococcus furiosus, hyperthermophile, UNKNOWN FUNCTION ;; STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1yem__assembly_1__model_1`	dimeric （2）	Excluded	—	—
	Exclusion reason： The source record does not identify the atom or ion element unambiguously, so a reliable calculation is not possible.

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Conserved hypothetical protein Pfu-838710-001
Molecular weight formula_weight	21419.4 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	2721

MHHHHHHGSEVEIKFKIKLEDFLHTLNTFNPEFVRYEEQEDVYFEVPRPKLLRIRGVHNLKKYYLTFKEILDENNEEFYEVEFEIGDFEKAVEVFKRLGFKIQATIKKKRWVYKLNGVTLEVNRVEGIGDFVDIEVISDSPEEAKEKIWEVAKMLGLKEEDVEPRLYLELINELSGRSS

Source Source

Source organism organism	Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)
NCBI taxonomy ID ncbi_taxonomy_id	186497
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	PLATINUM (II) ION
Molecular weight formula_weight	195.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 3 Entity 3 non-polymer

Description description	UNKNOWN ATOM OR ION
Source method src_method	syn
Copy count entity_count	7

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	17

▼

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d1yema1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.63 — CYTH-like phosphatases
Superfamily Superfamily superfamily	d.63.1 — CYTH-like phosphatases
Family Family family	d.63.1.2 — CYTH domain

Domain ID domain_id	d1yema2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d1yemb1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.63 — CYTH-like phosphatases
Superfamily Superfamily superfamily	d.63.1 — CYTH-like phosphatases
Family Family family	d.63.1.2 — CYTH domain

Domain ID domain_id	d1yemb2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

CATH v4.4 (2 domains)

Domain ID domain_id	1yemA00
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	320 — Hypothetical Protein Pfu-838710-001
Homologous superfamily homologous superfamily	10 — Hypothetical Protein Pfu-838710-001

Domain ID domain_id	1yemB00
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	320 — Hypothetical Protein Pfu-838710-001
Homologous superfamily homologous superfamily	10 — Hypothetical Protein Pfu-838710-001

▶

Unit-cell length a length_a	97.016 Å
Unit-cell length b length_b	97.016 Å
Unit-cell length c length_c	127.590 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	12

Space group space_group	P 31 2 1
Space-group number int_tables_number	152
Crystal system crystal_system	—

Resolution resolution	2.300 Å
Low-resolution limit resolution_low	37.932 Å
R factor r_factor	0.2246
R_work r_work	0.2228
R_free r_free	0.2578

Conserved hypothetical protein Pfu-838710-001 from Pyrococcus furiosus

1. Protein Identity and Related Structures Protein Identity & Related Structures

Conserved hypothetical protein Pfu-838710-001

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (4 domains)

CATH v4.4 (2 domains)

7. Citations (1)

Conserved hypothetical protein Pfu-838710-001 from Pyrococcus furiosus

1. Protein Identity and Related Structures Protein Identity & Related Structures

Conserved hypothetical protein Pfu-838710-001

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 non-polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (4 domains)

CATH v4.4 (2 domains)

7. Citations (1)