1yjw

Crystal Structure Of Quinupristin Bound To The G2099A Mutant 50S Ribosomal Subunit Of Haloarcula Marismortui

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

50S ribosomal protein L37e

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 30 RNA 2	23S RIBOSOMAL RNA × 1 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44e × 1 （P32411） QUINUPRISTIN × 1 5S RIBOSOMAL RNA × 1 50S ribosomal protein L2 × 1 （P20276） 50S ribosomal protein L3 × 1 （P20279） 50S ribosomal protein L4 × 1 （P12735） 50S ribosomal protein L5 × 1 （P14124） 50S ribosomal protein L6 × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10 × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11 × 1 （P14122） 50S ribosomal protein L13 × 1 （P29198） 50S ribosomal protein L14 × 1 （P22450） 50S ribosomal protein L15 × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18 × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22 × 1 （P10970） 50S ribosomal protein L23 × 1 （P12732） 50S ribosomal protein L24 × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29 × 1 （P10971） 50S ribosomal protein L30 × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 （P60619） MAGNESIUM ION × 117 POTASSIUM ION × 2 SODIUM ION × 86 CHLORIDE ION × 22 CADMIUM ION × 5 water × 32	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL37_HALMA
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain 1； PDBConstruct 1–57； UniProt 1–57

50S ribosomal protein L39e

OrganismNot specified

UniProt P22452

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 30 RNA 2	23S RIBOSOMAL RNA × 1 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L44e × 1 （P32411） QUINUPRISTIN × 1 5S RIBOSOMAL RNA × 1 50S ribosomal protein L2 × 1 （P20276） 50S ribosomal protein L3 × 1 （P20279） 50S ribosomal protein L4 × 1 （P12735） 50S ribosomal protein L5 × 1 （P14124） 50S ribosomal protein L6 × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10 × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11 × 1 （P14122） 50S ribosomal protein L13 × 1 （P29198） 50S ribosomal protein L14 × 1 （P22450） 50S ribosomal protein L15 × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18 × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22 × 1 （P10970） 50S ribosomal protein L23 × 1 （P12732） 50S ribosomal protein L24 × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29 × 1 （P10971） 50S ribosomal protein L30 × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 （P60619） MAGNESIUM ION × 117 POTASSIUM ION × 2 SODIUM ION × 86 CHLORIDE ION × 22 CADMIUM ION × 5 water × 32	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL39_HALMA
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain 2； PDBConstruct 1–50； UniProt 1–50

50S ribosomal protein L44e

OrganismNot specified

UniProt P32411

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 30 RNA 2	23S RIBOSOMAL RNA × 1 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） QUINUPRISTIN × 1 5S RIBOSOMAL RNA × 1 50S ribosomal protein L2 × 1 （P20276） 50S ribosomal protein L3 × 1 （P20279） 50S ribosomal protein L4 × 1 （P12735） 50S ribosomal protein L5 × 1 （P14124） 50S ribosomal protein L6 × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10 × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11 × 1 （P14122） 50S ribosomal protein L13 × 1 （P29198） 50S ribosomal protein L14 × 1 （P22450） 50S ribosomal protein L15 × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18 × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22 × 1 （P10970） 50S ribosomal protein L23 × 1 （P12732） 50S ribosomal protein L24 × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29 × 1 （P10971） 50S ribosomal protein L30 × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 （P60619） MAGNESIUM ION × 117 POTASSIUM ION × 2 SODIUM ION × 86 CHLORIDE ION × 22 CADMIUM ION × 5 water × 32	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL44E_HALMA
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain 3； PDBConstruct 1–92； UniProt 1–92

50S ribosomal protein L2

OrganismNot specified

UniProt P20276

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 30 RNA 2	23S RIBOSOMAL RNA × 1 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44e × 1 （P32411） QUINUPRISTIN × 1 5S RIBOSOMAL RNA × 1 50S ribosomal protein L3 × 1 （P20279） 50S ribosomal protein L4 × 1 （P12735） 50S ribosomal protein L5 × 1 （P14124） 50S ribosomal protein L6 × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10 × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11 × 1 （P14122） 50S ribosomal protein L13 × 1 （P29198） 50S ribosomal protein L14 × 1 （P22450） 50S ribosomal protein L15 × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18 × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22 × 1 （P10970） 50S ribosomal protein L23 × 1 （P12732） 50S ribosomal protein L24 × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29 × 1 （P10971） 50S ribosomal protein L30 × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 （P60619） MAGNESIUM ION × 117 POTASSIUM ION × 2 SODIUM ION × 86 CHLORIDE ION × 22 CADMIUM ION × 5 water × 32	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL2_HALMA
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain A； PDBConstruct 1–240； UniProt 1–240

50S ribosomal protein L3

OrganismNot specified

UniProt P20279

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 30 RNA 2	23S RIBOSOMAL RNA × 1 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44e × 1 （P32411） QUINUPRISTIN × 1 5S RIBOSOMAL RNA × 1 50S ribosomal protein L2 × 1 （P20276） 50S ribosomal protein L4 × 1 （P12735） 50S ribosomal protein L5 × 1 （P14124） 50S ribosomal protein L6 × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10 × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11 × 1 （P14122） 50S ribosomal protein L13 × 1 （P29198） 50S ribosomal protein L14 × 1 （P22450） 50S ribosomal protein L15 × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18 × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22 × 1 （P10970） 50S ribosomal protein L23 × 1 （P12732） 50S ribosomal protein L24 × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29 × 1 （P10971） 50S ribosomal protein L30 × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 （P60619） MAGNESIUM ION × 117 POTASSIUM ION × 2 SODIUM ION × 86 CHLORIDE ION × 22 CADMIUM ION × 5 water × 32	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL3_HALMA
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain B； PDBConstruct 1–338； UniProt 1–338

50S ribosomal protein L4

OrganismNot specified

UniProt P12735

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 30 RNA 2	23S RIBOSOMAL RNA × 1 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44e × 1 （P32411） QUINUPRISTIN × 1 5S RIBOSOMAL RNA × 1 50S ribosomal protein L2 × 1 （P20276） 50S ribosomal protein L3 × 1 （P20279） 50S ribosomal protein L5 × 1 （P14124） 50S ribosomal protein L6 × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10 × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11 × 1 （P14122） 50S ribosomal protein L13 × 1 （P29198） 50S ribosomal protein L14 × 1 （P22450） 50S ribosomal protein L15 × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18 × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22 × 1 （P10970） 50S ribosomal protein L23 × 1 （P12732） 50S ribosomal protein L24 × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29 × 1 （P10971） 50S ribosomal protein L30 × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 （P60619） MAGNESIUM ION × 117 POTASSIUM ION × 2 SODIUM ION × 86 CHLORIDE ION × 22 CADMIUM ION × 5 water × 32	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL4_HALMA
Isoform	—
PDB entities	9
Chains and sequence ranges	Author chain C； PDBConstruct 1–246； UniProt 1–246

50S ribosomal protein L5

OrganismNot specified

UniProt P14124

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 30 RNA 2	23S RIBOSOMAL RNA × 1 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44e × 1 （P32411） QUINUPRISTIN × 1 5S RIBOSOMAL RNA × 1 50S ribosomal protein L2 × 1 （P20276） 50S ribosomal protein L3 × 1 （P20279） 50S ribosomal protein L4 × 1 （P12735） 50S ribosomal protein L6 × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10 × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11 × 1 （P14122） 50S ribosomal protein L13 × 1 （P29198） 50S ribosomal protein L14 × 1 （P22450） 50S ribosomal protein L15 × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18 × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22 × 1 （P10970） 50S ribosomal protein L23 × 1 （P12732） 50S ribosomal protein L24 × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29 × 1 （P10971） 50S ribosomal protein L30 × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 （P60619） MAGNESIUM ION × 117 POTASSIUM ION × 2 SODIUM ION × 86 CHLORIDE ION × 22 CADMIUM ION × 5 water × 32	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL5_HALMA
Isoform	—
PDB entities	10
Chains and sequence ranges	Author chain D； PDBConstruct 1–177； UniProt 1–177

50S ribosomal protein L6

OrganismNot specified

UniProt P14135

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 30 RNA 2	23S RIBOSOMAL RNA × 1 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44e × 1 （P32411） QUINUPRISTIN × 1 5S RIBOSOMAL RNA × 1 50S ribosomal protein L2 × 1 （P20276） 50S ribosomal protein L3 × 1 （P20279） 50S ribosomal protein L4 × 1 （P12735） 50S ribosomal protein L5 × 1 （P14124） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10 × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11 × 1 （P14122） 50S ribosomal protein L13 × 1 （P29198） 50S ribosomal protein L14 × 1 （P22450） 50S ribosomal protein L15 × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18 × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22 × 1 （P10970） 50S ribosomal protein L23 × 1 （P12732） 50S ribosomal protein L24 × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29 × 1 （P10971） 50S ribosomal protein L30 × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 （P60619） MAGNESIUM ION × 117 POTASSIUM ION × 2 SODIUM ION × 86 CHLORIDE ION × 22 CADMIUM ION × 5 water × 32	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL6_HALMA
Isoform	—
PDB entities	11
Chains and sequence ranges	Author chain E； PDBConstruct 1–178； UniProt 1–178

50S ribosomal protein L7Ae

OrganismNot specified

UniProt P12743

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 30 RNA 2	23S RIBOSOMAL RNA × 1 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44e × 1 （P32411） QUINUPRISTIN × 1 5S RIBOSOMAL RNA × 1 50S ribosomal protein L2 × 1 （P20276） 50S ribosomal protein L3 × 1 （P20279） 50S ribosomal protein L4 × 1 （P12735） 50S ribosomal protein L5 × 1 （P14124） 50S ribosomal protein L6 × 1 （P14135） 50S ribosomal protein L10 × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11 × 1 （P14122） 50S ribosomal protein L13 × 1 （P29198） 50S ribosomal protein L14 × 1 （P22450） 50S ribosomal protein L15 × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18 × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22 × 1 （P10970） 50S ribosomal protein L23 × 1 （P12732） 50S ribosomal protein L24 × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29 × 1 （P10971） 50S ribosomal protein L30 × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 （P60619） MAGNESIUM ION × 117 POTASSIUM ION × 2 SODIUM ION × 86 CHLORIDE ION × 22 CADMIUM ION × 5 water × 32	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL7A_HALMA
Isoform	—
PDB entities	12
Chains and sequence ranges	Author chain F； PDBConstruct 1–120； UniProt 1–120

50S ribosomal protein L10

OrganismNot specified

UniProt P15825

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 30 RNA 2	23S RIBOSOMAL RNA × 1 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44e × 1 （P32411） QUINUPRISTIN × 1 5S RIBOSOMAL RNA × 1 50S ribosomal protein L2 × 1 （P20276） 50S ribosomal protein L3 × 1 （P20279） 50S ribosomal protein L4 × 1 （P12735） 50S ribosomal protein L5 × 1 （P14124） 50S ribosomal protein L6 × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11 × 1 （P14122） 50S ribosomal protein L13 × 1 （P29198） 50S ribosomal protein L14 × 1 （P22450） 50S ribosomal protein L15 × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18 × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22 × 1 （P10970） 50S ribosomal protein L23 × 1 （P12732） 50S ribosomal protein L24 × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29 × 1 （P10971） 50S ribosomal protein L30 × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 （P60619） MAGNESIUM ION × 117 POTASSIUM ION × 2 SODIUM ION × 86 CHLORIDE ION × 22 CADMIUM ION × 5 water × 32	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL10_HALMA
Isoform	—
PDB entities	13
Chains and sequence ranges	Author chain G； PDBConstruct 1–348； UniProt 1–348

50S ribosomal protein L10e

OrganismNot specified

UniProt P60617

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 30 RNA 2	23S RIBOSOMAL RNA × 1 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44e × 1 （P32411） QUINUPRISTIN × 1 5S RIBOSOMAL RNA × 1 50S ribosomal protein L2 × 1 （P20276） 50S ribosomal protein L3 × 1 （P20279） 50S ribosomal protein L4 × 1 （P12735） 50S ribosomal protein L5 × 1 （P14124） 50S ribosomal protein L6 × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10 × 1 （P15825） 50S ribosomal protein L11 × 1 （P14122） 50S ribosomal protein L13 × 1 （P29198） 50S ribosomal protein L14 × 1 （P22450） 50S ribosomal protein L15 × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18 × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22 × 1 （P10970） 50S ribosomal protein L23 × 1 （P12732） 50S ribosomal protein L24 × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29 × 1 （P10971） 50S ribosomal protein L30 × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 （P60619） MAGNESIUM ION × 117 POTASSIUM ION × 2 SODIUM ION × 86 CHLORIDE ION × 22 CADMIUM ION × 5 water × 32	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL10E_HALMA
Isoform	—
PDB entities	14
Chains and sequence ranges	Author chain H； PDBConstruct 1–177； UniProt 1–177

50S ribosomal protein L11

OrganismNot specified

UniProt P14122

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 30 RNA 2	23S RIBOSOMAL RNA × 1 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44e × 1 （P32411） QUINUPRISTIN × 1 5S RIBOSOMAL RNA × 1 50S ribosomal protein L2 × 1 （P20276） 50S ribosomal protein L3 × 1 （P20279） 50S ribosomal protein L4 × 1 （P12735） 50S ribosomal protein L5 × 1 （P14124） 50S ribosomal protein L6 × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10 × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L13 × 1 （P29198） 50S ribosomal protein L14 × 1 （P22450） 50S ribosomal protein L15 × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18 × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22 × 1 （P10970） 50S ribosomal protein L23 × 1 （P12732） 50S ribosomal protein L24 × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29 × 1 （P10971） 50S ribosomal protein L30 × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 （P60619） MAGNESIUM ION × 117 POTASSIUM ION × 2 SODIUM ION × 86 CHLORIDE ION × 22 CADMIUM ION × 5 water × 32	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL11_HALMA
Isoform	—
PDB entities	15
Chains and sequence ranges	Author chain I； PDBConstruct 1–162； UniProt 1–162

50S ribosomal protein L13

OrganismNot specified

UniProt P29198

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 30 RNA 2	23S RIBOSOMAL RNA × 1 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44e × 1 （P32411） QUINUPRISTIN × 1 5S RIBOSOMAL RNA × 1 50S ribosomal protein L2 × 1 （P20276） 50S ribosomal protein L3 × 1 （P20279） 50S ribosomal protein L4 × 1 （P12735） 50S ribosomal protein L5 × 1 （P14124） 50S ribosomal protein L6 × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10 × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11 × 1 （P14122） 50S ribosomal protein L14 × 1 （P22450） 50S ribosomal protein L15 × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18 × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22 × 1 （P10970） 50S ribosomal protein L23 × 1 （P12732） 50S ribosomal protein L24 × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29 × 1 （P10971） 50S ribosomal protein L30 × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 （P60619） MAGNESIUM ION × 117 POTASSIUM ION × 2 SODIUM ION × 86 CHLORIDE ION × 22 CADMIUM ION × 5 water × 32	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL13_HALMA
Isoform	—
PDB entities	16
Chains and sequence ranges	Author chain J； PDBConstruct 1–145； UniProt 1–145

50S ribosomal protein L14

OrganismNot specified

UniProt P22450

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 30 RNA 2	23S RIBOSOMAL RNA × 1 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44e × 1 （P32411） QUINUPRISTIN × 1 5S RIBOSOMAL RNA × 1 50S ribosomal protein L2 × 1 （P20276） 50S ribosomal protein L3 × 1 （P20279） 50S ribosomal protein L4 × 1 （P12735） 50S ribosomal protein L5 × 1 （P14124） 50S ribosomal protein L6 × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10 × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11 × 1 （P14122） 50S ribosomal protein L13 × 1 （P29198） 50S ribosomal protein L15 × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18 × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22 × 1 （P10970） 50S ribosomal protein L23 × 1 （P12732） 50S ribosomal protein L24 × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29 × 1 （P10971） 50S ribosomal protein L30 × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 （P60619） MAGNESIUM ION × 117 POTASSIUM ION × 2 SODIUM ION × 86 CHLORIDE ION × 22 CADMIUM ION × 5 water × 32	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL14_HALMA
Isoform	—
PDB entities	17
Chains and sequence ranges	Author chain K； PDBConstruct 1–132； UniProt 1–132

50S ribosomal protein L15

OrganismNot specified

UniProt P12737

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 30 RNA 2	23S RIBOSOMAL RNA × 1 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44e × 1 （P32411） QUINUPRISTIN × 1 5S RIBOSOMAL RNA × 1 50S ribosomal protein L2 × 1 （P20276） 50S ribosomal protein L3 × 1 （P20279） 50S ribosomal protein L4 × 1 （P12735） 50S ribosomal protein L5 × 1 （P14124） 50S ribosomal protein L6 × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10 × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11 × 1 （P14122） 50S ribosomal protein L13 × 1 （P29198） 50S ribosomal protein L14 × 1 （P22450） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18 × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22 × 1 （P10970） 50S ribosomal protein L23 × 1 （P12732） 50S ribosomal protein L24 × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29 × 1 （P10971） 50S ribosomal protein L30 × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 （P60619） MAGNESIUM ION × 117 POTASSIUM ION × 2 SODIUM ION × 86 CHLORIDE ION × 22 CADMIUM ION × 5 water × 32	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL15_HALMA
Isoform	—
PDB entities	18
Chains and sequence ranges	Author chain L； PDBConstruct 1–165； UniProt 1–165

50S ribosomal protein L15e

OrganismNot specified

UniProt P60618

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 30 RNA 2	23S RIBOSOMAL RNA × 1 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44e × 1 （P32411） QUINUPRISTIN × 1 5S RIBOSOMAL RNA × 1 50S ribosomal protein L2 × 1 （P20276） 50S ribosomal protein L3 × 1 （P20279） 50S ribosomal protein L4 × 1 （P12735） 50S ribosomal protein L5 × 1 （P14124） 50S ribosomal protein L6 × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10 × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11 × 1 （P14122） 50S ribosomal protein L13 × 1 （P29198） 50S ribosomal protein L14 × 1 （P22450） 50S ribosomal protein L15 × 1 （P12737） 50S ribosomal protein L18 × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22 × 1 （P10970） 50S ribosomal protein L23 × 1 （P12732） 50S ribosomal protein L24 × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29 × 1 （P10971） 50S ribosomal protein L30 × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 （P60619） MAGNESIUM ION × 117 POTASSIUM ION × 2 SODIUM ION × 86 CHLORIDE ION × 22 CADMIUM ION × 5 water × 32	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL15E_HALMA
Isoform	—
PDB entities	19
Chains and sequence ranges	Author chain M； PDBConstruct 1–195； UniProt 1–195

50S ribosomal protein L18

OrganismNot specified

UniProt P14123

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 30 RNA 2	23S RIBOSOMAL RNA × 1 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44e × 1 （P32411） QUINUPRISTIN × 1 5S RIBOSOMAL RNA × 1 50S ribosomal protein L2 × 1 （P20276） 50S ribosomal protein L3 × 1 （P20279） 50S ribosomal protein L4 × 1 （P12735） 50S ribosomal protein L5 × 1 （P14124） 50S ribosomal protein L6 × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10 × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11 × 1 （P14122） 50S ribosomal protein L13 × 1 （P29198） 50S ribosomal protein L14 × 1 （P22450） 50S ribosomal protein L15 × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22 × 1 （P10970） 50S ribosomal protein L23 × 1 （P12732） 50S ribosomal protein L24 × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29 × 1 （P10971） 50S ribosomal protein L30 × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 （P60619） MAGNESIUM ION × 117 POTASSIUM ION × 2 SODIUM ION × 86 CHLORIDE ION × 22 CADMIUM ION × 5 water × 32	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL18_HALMA
Isoform	—
PDB entities	20
Chains and sequence ranges	Author chain N； PDBConstruct 1–187； UniProt 1–187

50S ribosomal protein L18e

OrganismNot specified

UniProt P12733

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 30 RNA 2	23S RIBOSOMAL RNA × 1 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44e × 1 （P32411） QUINUPRISTIN × 1 5S RIBOSOMAL RNA × 1 50S ribosomal protein L2 × 1 （P20276） 50S ribosomal protein L3 × 1 （P20279） 50S ribosomal protein L4 × 1 （P12735） 50S ribosomal protein L5 × 1 （P14124） 50S ribosomal protein L6 × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10 × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11 × 1 （P14122） 50S ribosomal protein L13 × 1 （P29198） 50S ribosomal protein L14 × 1 （P22450） 50S ribosomal protein L15 × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18 × 1 （P14123） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22 × 1 （P10970） 50S ribosomal protein L23 × 1 （P12732） 50S ribosomal protein L24 × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29 × 1 （P10971） 50S ribosomal protein L30 × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 （P60619） MAGNESIUM ION × 117 POTASSIUM ION × 2 SODIUM ION × 86 CHLORIDE ION × 22 CADMIUM ION × 5 water × 32	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL18E_HALMA
Isoform	—
PDB entities	21
Chains and sequence ranges	Author chain O； PDBConstruct 1–116； UniProt 1–116

50S ribosomal protein L19e

OrganismNot specified

UniProt P14119

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 30 RNA 2	23S RIBOSOMAL RNA × 1 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44e × 1 （P32411） QUINUPRISTIN × 1 5S RIBOSOMAL RNA × 1 50S ribosomal protein L2 × 1 （P20276） 50S ribosomal protein L3 × 1 （P20279） 50S ribosomal protein L4 × 1 （P12735） 50S ribosomal protein L5 × 1 （P14124） 50S ribosomal protein L6 × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10 × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11 × 1 （P14122） 50S ribosomal protein L13 × 1 （P29198） 50S ribosomal protein L14 × 1 （P22450） 50S ribosomal protein L15 × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18 × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22 × 1 （P10970） 50S ribosomal protein L23 × 1 （P12732） 50S ribosomal protein L24 × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29 × 1 （P10971） 50S ribosomal protein L30 × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 （P60619） MAGNESIUM ION × 117 POTASSIUM ION × 2 SODIUM ION × 86 CHLORIDE ION × 22 CADMIUM ION × 5 water × 32	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL19E_HALMA
Isoform	—
PDB entities	22
Chains and sequence ranges	Author chain P； PDBConstruct 1–149； UniProt 1–149

50S ribosomal protein L21e

OrganismNot specified

UniProt P12734

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 30 RNA 2	23S RIBOSOMAL RNA × 1 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44e × 1 （P32411） QUINUPRISTIN × 1 5S RIBOSOMAL RNA × 1 50S ribosomal protein L2 × 1 （P20276） 50S ribosomal protein L3 × 1 （P20279） 50S ribosomal protein L4 × 1 （P12735） 50S ribosomal protein L5 × 1 （P14124） 50S ribosomal protein L6 × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10 × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11 × 1 （P14122） 50S ribosomal protein L13 × 1 （P29198） 50S ribosomal protein L14 × 1 （P22450） 50S ribosomal protein L15 × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18 × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L22 × 1 （P10970） 50S ribosomal protein L23 × 1 （P12732） 50S ribosomal protein L24 × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29 × 1 （P10971） 50S ribosomal protein L30 × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 （P60619） MAGNESIUM ION × 117 POTASSIUM ION × 2 SODIUM ION × 86 CHLORIDE ION × 22 CADMIUM ION × 5 water × 32	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL21_HALMA
Isoform	—
PDB entities	23
Chains and sequence ranges	Author chain Q； PDBConstruct 1–96； UniProt 1–96

50S ribosomal protein L22

OrganismNot specified

UniProt P10970

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 30 RNA 2	23S RIBOSOMAL RNA × 1 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44e × 1 （P32411） QUINUPRISTIN × 1 5S RIBOSOMAL RNA × 1 50S ribosomal protein L2 × 1 （P20276） 50S ribosomal protein L3 × 1 （P20279） 50S ribosomal protein L4 × 1 （P12735） 50S ribosomal protein L5 × 1 （P14124） 50S ribosomal protein L6 × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10 × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11 × 1 （P14122） 50S ribosomal protein L13 × 1 （P29198） 50S ribosomal protein L14 × 1 （P22450） 50S ribosomal protein L15 × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18 × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L23 × 1 （P12732） 50S ribosomal protein L24 × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29 × 1 （P10971） 50S ribosomal protein L30 × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 （P60619） MAGNESIUM ION × 117 POTASSIUM ION × 2 SODIUM ION × 86 CHLORIDE ION × 22 CADMIUM ION × 5 water × 32	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL22_HALMA
Isoform	—
PDB entities	24
Chains and sequence ranges	Author chain R； PDBConstruct 1–155； UniProt 1–155

50S ribosomal protein L23

OrganismNot specified

UniProt P12732

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 30 RNA 2	23S RIBOSOMAL RNA × 1 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44e × 1 （P32411） QUINUPRISTIN × 1 5S RIBOSOMAL RNA × 1 50S ribosomal protein L2 × 1 （P20276） 50S ribosomal protein L3 × 1 （P20279） 50S ribosomal protein L4 × 1 （P12735） 50S ribosomal protein L5 × 1 （P14124） 50S ribosomal protein L6 × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10 × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11 × 1 （P14122） 50S ribosomal protein L13 × 1 （P29198） 50S ribosomal protein L14 × 1 （P22450） 50S ribosomal protein L15 × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18 × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22 × 1 （P10970） 50S ribosomal protein L24 × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29 × 1 （P10971） 50S ribosomal protein L30 × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 （P60619） MAGNESIUM ION × 117 POTASSIUM ION × 2 SODIUM ION × 86 CHLORIDE ION × 22 CADMIUM ION × 5 water × 32	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL23_HALMA
Isoform	—
PDB entities	25
Chains and sequence ranges	Author chain S； PDBConstruct 1–85； UniProt 1–85

50S ribosomal protein L24

OrganismNot specified

UniProt P10972

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 30 RNA 2	23S RIBOSOMAL RNA × 1 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44e × 1 （P32411） QUINUPRISTIN × 1 5S RIBOSOMAL RNA × 1 50S ribosomal protein L2 × 1 （P20276） 50S ribosomal protein L3 × 1 （P20279） 50S ribosomal protein L4 × 1 （P12735） 50S ribosomal protein L5 × 1 （P14124） 50S ribosomal protein L6 × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10 × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11 × 1 （P14122） 50S ribosomal protein L13 × 1 （P29198） 50S ribosomal protein L14 × 1 （P22450） 50S ribosomal protein L15 × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18 × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22 × 1 （P10970） 50S ribosomal protein L23 × 1 （P12732） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29 × 1 （P10971） 50S ribosomal protein L30 × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 （P60619） MAGNESIUM ION × 117 POTASSIUM ION × 2 SODIUM ION × 86 CHLORIDE ION × 22 CADMIUM ION × 5 water × 32	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL24_HALMA
Isoform	—
PDB entities	26
Chains and sequence ranges	Author chain T； PDBConstruct 1–120； UniProt 1–120

50S ribosomal protein L24e

OrganismNot specified

UniProt P14116

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 30 RNA 2	23S RIBOSOMAL RNA × 1 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44e × 1 （P32411） QUINUPRISTIN × 1 5S RIBOSOMAL RNA × 1 50S ribosomal protein L2 × 1 （P20276） 50S ribosomal protein L3 × 1 （P20279） 50S ribosomal protein L4 × 1 （P12735） 50S ribosomal protein L5 × 1 （P14124） 50S ribosomal protein L6 × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10 × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11 × 1 （P14122） 50S ribosomal protein L13 × 1 （P29198） 50S ribosomal protein L14 × 1 （P22450） 50S ribosomal protein L15 × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18 × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22 × 1 （P10970） 50S ribosomal protein L23 × 1 （P12732） 50S ribosomal protein L24 × 1 （P10972） 50S ribosomal protein L29 × 1 （P10971） 50S ribosomal protein L30 × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 （P60619） MAGNESIUM ION × 117 POTASSIUM ION × 2 SODIUM ION × 86 CHLORIDE ION × 22 CADMIUM ION × 5 water × 32	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL24E_HALMA
Isoform	—
PDB entities	27
Chains and sequence ranges	Author chain U； PDBConstruct 1–66； UniProt 2–67

50S ribosomal protein L29

OrganismNot specified

UniProt P10971

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 30 RNA 2	23S RIBOSOMAL RNA × 1 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44e × 1 （P32411） QUINUPRISTIN × 1 5S RIBOSOMAL RNA × 1 50S ribosomal protein L2 × 1 （P20276） 50S ribosomal protein L3 × 1 （P20279） 50S ribosomal protein L4 × 1 （P12735） 50S ribosomal protein L5 × 1 （P14124） 50S ribosomal protein L6 × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10 × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11 × 1 （P14122） 50S ribosomal protein L13 × 1 （P29198） 50S ribosomal protein L14 × 1 （P22450） 50S ribosomal protein L15 × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18 × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22 × 1 （P10970） 50S ribosomal protein L23 × 1 （P12732） 50S ribosomal protein L24 × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L30 × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 （P60619） MAGNESIUM ION × 117 POTASSIUM ION × 2 SODIUM ION × 86 CHLORIDE ION × 22 CADMIUM ION × 5 water × 32	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL29_HALMA
Isoform	—
PDB entities	28
Chains and sequence ranges	Author chain V； PDBConstruct 1–71； UniProt 1–71

50S ribosomal protein L30

OrganismNot specified

UniProt P14121

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 30 RNA 2	23S RIBOSOMAL RNA × 1 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44e × 1 （P32411） QUINUPRISTIN × 1 5S RIBOSOMAL RNA × 1 50S ribosomal protein L2 × 1 （P20276） 50S ribosomal protein L3 × 1 （P20279） 50S ribosomal protein L4 × 1 （P12735） 50S ribosomal protein L5 × 1 （P14124） 50S ribosomal protein L6 × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10 × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11 × 1 （P14122） 50S ribosomal protein L13 × 1 （P29198） 50S ribosomal protein L14 × 1 （P22450） 50S ribosomal protein L15 × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18 × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22 × 1 （P10970） 50S ribosomal protein L23 × 1 （P12732） 50S ribosomal protein L24 × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29 × 1 （P10971） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 （P60619） MAGNESIUM ION × 117 POTASSIUM ION × 2 SODIUM ION × 86 CHLORIDE ION × 22 CADMIUM ION × 5 water × 32	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL30_HALMA
Isoform	—
PDB entities	29
Chains and sequence ranges	Author chain W； PDBConstruct 1–154； UniProt 1–154

50S ribosomal protein L31e

OrganismNot specified

UniProt P18138

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 30 RNA 2	23S RIBOSOMAL RNA × 1 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44e × 1 （P32411） QUINUPRISTIN × 1 5S RIBOSOMAL RNA × 1 50S ribosomal protein L2 × 1 （P20276） 50S ribosomal protein L3 × 1 （P20279） 50S ribosomal protein L4 × 1 （P12735） 50S ribosomal protein L5 × 1 （P14124） 50S ribosomal protein L6 × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10 × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11 × 1 （P14122） 50S ribosomal protein L13 × 1 （P29198） 50S ribosomal protein L14 × 1 （P22450） 50S ribosomal protein L15 × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18 × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22 × 1 （P10970） 50S ribosomal protein L23 × 1 （P12732） 50S ribosomal protein L24 × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29 × 1 （P10971） 50S ribosomal protein L30 × 1 （P14121） 50S ribosomal protein L32e × 1 （P12736） 50S ribosomal protein L37Ae × 1 （P60619） MAGNESIUM ION × 117 POTASSIUM ION × 2 SODIUM ION × 86 CHLORIDE ION × 22 CADMIUM ION × 5 water × 32	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL31_HALMA
Isoform	—
PDB entities	30
Chains and sequence ranges	Author chain X； PDBConstruct 1–92； UniProt 1–92

50S ribosomal protein L32e

OrganismNot specified

UniProt P12736

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 30 RNA 2	23S RIBOSOMAL RNA × 1 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44e × 1 （P32411） QUINUPRISTIN × 1 5S RIBOSOMAL RNA × 1 50S ribosomal protein L2 × 1 （P20276） 50S ribosomal protein L3 × 1 （P20279） 50S ribosomal protein L4 × 1 （P12735） 50S ribosomal protein L5 × 1 （P14124） 50S ribosomal protein L6 × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10 × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11 × 1 （P14122） 50S ribosomal protein L13 × 1 （P29198） 50S ribosomal protein L14 × 1 （P22450） 50S ribosomal protein L15 × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18 × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22 × 1 （P10970） 50S ribosomal protein L23 × 1 （P12732） 50S ribosomal protein L24 × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29 × 1 （P10971） 50S ribosomal protein L30 × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L37Ae × 1 （P60619） MAGNESIUM ION × 117 POTASSIUM ION × 2 SODIUM ION × 86 CHLORIDE ION × 22 CADMIUM ION × 5 water × 32	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL32_HALMA
Isoform	—
PDB entities	31
Chains and sequence ranges	Author chain Y； PDBConstruct 1–241； UniProt 1–241

50S ribosomal protein L37Ae

OrganismNot specified

UniProt P60619

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Heteromer	Protein 30 RNA 2	23S RIBOSOMAL RNA × 1 50S ribosomal protein L37e × 1 （P32410） 50S ribosomal protein L39e × 1 （P22452） 50S ribosomal protein L44e × 1 （P32411） QUINUPRISTIN × 1 5S RIBOSOMAL RNA × 1 50S ribosomal protein L2 × 1 （P20276） 50S ribosomal protein L3 × 1 （P20279） 50S ribosomal protein L4 × 1 （P12735） 50S ribosomal protein L5 × 1 （P14124） 50S ribosomal protein L6 × 1 （P14135） 50S ribosomal protein L7Ae × 1 （P12743） 50S ribosomal protein L10 × 1 （P15825） 50S ribosomal protein L10e × 1 （P60617） 50S ribosomal protein L11 × 1 （P14122） 50S ribosomal protein L13 × 1 （P29198） 50S ribosomal protein L14 × 1 （P22450） 50S ribosomal protein L15 × 1 （P12737） 50S ribosomal protein L15e × 1 （P60618） 50S ribosomal protein L18 × 1 （P14123） 50S ribosomal protein L18e × 1 （P12733） 50S ribosomal protein L19e × 1 （P14119） 50S ribosomal protein L21e × 1 （P12734） 50S ribosomal protein L22 × 1 （P10970） 50S ribosomal protein L23 × 1 （P12732） 50S ribosomal protein L24 × 1 （P10972） 50S ribosomal protein L24e × 1 （P14116） 50S ribosomal protein L29 × 1 （P10971） 50S ribosomal protein L30 × 1 （P14121） 50S ribosomal protein L31e × 1 （P18138） 50S ribosomal protein L32e × 1 （P12736） MAGNESIUM ION × 117 POTASSIUM ION × 2 SODIUM ION × 86 CHLORIDE ION × 22 CADMIUM ION × 5 water × 32	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RL37A_HALMA
Isoform	—
PDB entities	32
Chains and sequence ranges	Author chain Z； PDBConstruct 2–83； UniProt 11–92

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1yjw
Deposition date deposition_date	2005-01-15
Structure title title	Crystal Structure Of Quinupristin Bound To The G2099A Mutant 50S Ribosomal Subunit Of Haloarcula Marismortui
Keywords keywords	QUINUPRISTIN, DALFOPRISTIN, STREPTOGRAMIN, ANTIBIOTIC, MUTATED 50S SUBUNITS, RIBOSOME, RIBOSOME-ANTIBIOTIC COMPLEX; RIBOSOME/ANTIBIOTIC
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1yjw__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1yjw__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1yjw__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	68.68 Å
Rg (electron density)	69.56 Å
Total Rg	69.45 Å
Atom count	91301
Residues	6648
Excluded volume	1391000 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1yjw__assembly_1__model_1`	32-meric （32）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (38)

Entity 1 Entity 1 polymer

Description description	23S RIBOSOMAL RNA
Molecular weight formula_weight	946141.4 kDa
Mutation mutation	YES
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	0
Atom count atom_count	99111

GUUGGCUACUAUGCCAGCUGGUGGAUUGCUCGGCUCAGGCGCUGAUGAAGGACGUGCCAAGCUGCGAUAAGCUGUGGGGAGCCGCACGGAGGCGAAGAACCACAGAUUUCCGAAUGAGAAUCUCUCUAACAAUUGCUUCGCGCAAUGAGGAACCCCGAGAACUGAAACAUCUCAGUAUCGGGAGGAACAGAAAACGCAACGUGAUGUCGUUAGUAACCGCGAGUGAACGCGAUACAGCCCAAACCGAAGCCCUCACGGGCAAUGUGGUGUCAGGGCUACCUCUCAUCAGCCGACCGUCUUCACGAAGUCUCUUGGAAUAGAGCGUGAUACAGGGUGACAACCCCGUACUGAAGACCAGUACGCUGUGCGGUAGUGCCAGAGUAGCGGGGGUUGGAUAUCCCUCGCGAAUAACGCAGGCAUCGACUGCGAAGGCUAAACACAACCUGAGACCGAUAGUGAACAAGUAGUGUGAACGAACGCUGCAAAGUACCCUCAGAAGGGAGGCGAAAUAGAGCAUGAAAUCAGUUGGCGAUCGAGCGACAGGGCAUACAAGGUCCCUUGACGAAUGACCGAGACGCGAGUCUCCAGUAAGACUCACGGGAAGCCGAUGUUCUGUCGUACGUUUUGAAAAACGAGCCAGGGAGUGUGUCUGUAUGGCAAGUCUAACCGGAGUAUCCGGGGAGGCACAGGGAAACCGACAUGGCCGCAGGGCUUUGCCCGAGGGCCGCCGUCUUCAAGGGCGGGGAGCCAUGUGGACACGACCCGAAUCCGGACGAUCUACGCAUGGACAAGAUGAAGCGUGCCGAAAGGCACGUGGAAGUCUGUUAGAGUUGGUGUCCUACAAUACCCUCUCGUGAUCUAUGUGUAGGGGUGAAAGGCCCAUCGAGUCCGGCAACAGCUGGUUCCAAUCGAAACAUGUCGAAGCAUGACCUCCGCCGAGGUAGUCUGUGAGGUAGAGCGACCGAUUGGUGUGUCCGCCUCCGAGAGGAGUCGGCACACCUGUCAAACUCCAAACUUACAGACGCUGUUUGACGCGGGGAUUCCGGUGCGCGGGGUAAGCCUGUGUACCAGGAGGGGAACAACCCAGAGAUAGGUUAAGGUCCCCAAGUGUGGAUUAAGUGUAAUCCUCUGAAGGUGGUCUCGAGCCCUAGACAGCCGGGAGGUGAGCUUAGAAGCAGCUACCCUCUAAGAAAAGCGUAACAGCUUACCGGCCGAGGUUUGAGGCGCCCAAAAUGAUCGGGACUCAAAUCCACCACCGAGACCUGUCCGUACCACUCAUACUGGUAAUCGAGUAGAUUGGCGCUCUAAUUGGAUGGAAGCAGGGGCGAGAGCUCCUGUGGACCGAUUAGUGACGAAAAUCCUGGCCAUAGUAGCAGCGAUAGUCGGGUGAGAACCCCGACGGCCUAAUGGAUAAGGGUUCCUCAGCACUGCUGAUCAGCUGAGGGUUAGCCGGUCCUAAGUCUCACCGCAACUCGACUGAGACGAAAUGGGAAACAGGUUAAUAUUCCUGUGCCAUCAUGCAGUGAAAGUUGACGCCCUGGGGUCGAUCACGCCGGGCAUUCGCCCGGUCGAACCGUCCAACUCCGUGGAAGCCGUAAUGGCAGGAAGCGGACGAACGGCGGCAUAGGGAAACGUGAUUCAACCUGGGGCCCAUGAAAAGACGAGCAUGAUGUCCGUACCGAGAACCGACACAGGUGUCCAUGGCGGCGAAAGCCAAGGCCUGUCGGGAGCAACCAACGUUAGGGAAUUCGGCAAGUUAGUCCCGUACCUUCGGAAGAAGGGAUGCCUGCUCCGGAACGGAGCAGGUCGCAGUGACUCGGAAGCUCGGACUGUCUAGUAACAACAUAGGUGACCGCAAAUCCGCAAGGACUCGUACGGUCACUGAAUCCUGCCCAGUGCAGGUAUCUGAACACCUCGUACAAGAGGACGAAGGACCUGUCAACGGCGGGGGUAACUAUGACCCUCUUAAGGUAGCGUAGUACCUUGCCGCAUCAGUAGCGGCUUGCAUGAAUGGAUUAACCAGAGCUUCACUGUCCCAACGUUGGGCCCGGUGAACUGUACAUUCCAGUGCGGAGUCUGGAGACACCCAGGGGGAAGCAAAGACCCUAUGGAGCUUUACUGCAGGCUGUCGCUGAGACGUGGUCGCCGAUGUGCAGCAUAGGUAGGAGUCGUUACAGAGGUACCCGCGCUAGCGGGCCACCCAGACAACAGUGAAAUACUACCCGUCGGUGACUGCGACUCUCACUCCGGGAGGAGGACACCGAUAGCCGGGCAGUUUGACUGGGGCGGUACGCGCUCGAAAAGAUAUCGAGCGCGCCCUAUGGUCAUCUCAGCCGGGACAGAGACCCGGCGAAGAGUGCAAGAGCAAAAGAUGACUUGACAGUGUUCUUCCCAACGAGGAACGCUGACGCGAAAGCGUGGUCUAGCGAACCAAUUAGCCUGCUUGAUGCGGGCAAUUGAUGACAGAAAAGCUACCCUAGGGAUAACAGAGUCGUCACUCGCAAGAGCACAUAUCGACCGAGUGGCUUGCUACCUCGAUGUCGGUUCCCUCCAUCCUGCCCGUGCAGAAGCGGGCAAGGGUGAGGUUGUUCGCCUAUUAAAGGAGGUCGUGAGCUGGGUUUAGACCGUCGUGAGACAGGUCGGCUGCUAUCUACUGGGUGUGUAAUGGUGUCUGACAAGAACGACCGUAUAGUACGAGAGGAACUACGGUUGGUGGCCACUGGUGUACCGGUUGUUCGAGAGAGCACGUGCCGGGUAGCCACGCCACACGGGGUAAGAGCUGAACGCAUCUAAGCUCGAAACCCACUUGGAAAAGAGACACCGCCGAGGUCCCGCGUACAAGACGCGGUCGAUAGACUCGGGGUGUGCGCGUCGAGGUAACGAGACGUUAAGCCCACGAGCACUAACAGACCAAAGCCAUCA

Entity 2 Entity 2 polymer

Description description	50S ribosomal protein L37e
Molecular weight formula_weight	6330.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	1

MTGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE

Entity 3 Entity 3 polymer

Description description	50S ribosomal protein L39e
Molecular weight formula_weight	6133.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	2

MGKKSKATKKRLAKLDNQNSRVPAWVMLKTDREVQRNHKRRHWRRNDTDE

Entity 4 Entity 4 polymer

Description description	50S ribosomal protein L44e
Molecular weight formula_weight	10815.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	3

MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLREGWRAGRLEFQE

Entity 5 Entity 5 polymer

Description description	QUINUPRISTIN
Molecular weight formula_weight	1024.2 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	4

XTXPFXXX

Entity 6 Entity 6 polymer

Description description	5S RIBOSOMAL RNA
Molecular weight formula_weight	39303.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	9

UUAGGCGGCCACAGCGGUGGGGUUGCCUCCCGUACCCAUCCCGAACACGGAAGAUAAGCCCACCAGCGUUCCAGGGAGUACUGGAGUGCGCGAGCCUCUGGGAAAUCCGGUUCGCCGCCACC

Entity 7 Entity 7 polymer

Description description	50S ribosomal protein L2
Molecular weight formula_weight	25354.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MGRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDELQVGVSAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVVAGGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGGNE

Entity 8 Entity 8 polymer

Description description	50S ribosomal protein L3
Molecular weight formula_weight	37396.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MPQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPMRAVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKPDVMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNLGPWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAVRPNDQPRLDPEVRYVSNESNQG

Entity 9 Entity 9 polymer

Description description	50S ribosomal protein L4
Molecular weight formula_weight	26442.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKLDGRARRVPQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEALDVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESALAEVAER

Entity 10 Entity 10 polymer

Description description	50S ribosomal protein L5
Molecular weight formula_weight	19551.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MSSESESGGDFHEMREPRIEKVVVHMGIGHGGRDLANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEMAEEFLQTALPLAELATSQFDDTGNFSFGVEEHTEFPSQEYDPSIGIYGLDVTVNLVRPGYRVAKRDKASRSIPTKHRLNPADAVAFIESTYDVEVSE

Entity 11 Entity 11 polymer

Description description	50S ribosomal protein L6
Molecular weight formula_weight	19961.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MPRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEGWEYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVRVFQDGVYITRKPNRGDA

Entity 12 Entity 12 polymer

Description description	50S ribosomal protein L7Ae
Molecular weight formula_weight	12791.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MPVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQDDLGHAAGLEVGSAAAAVTDAGEADADVEDIADKVEELR

Entity 13 Entity 13 polymer

Description description	50S ribosomal protein L10
Molecular weight formula_weight	37213.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MSAESERKTETIPEWKQEEVDAIVEMIESYESVGVVNIAGIPSRQLQDMRRDLHGTAELRVSRNTLLERALDDVDDGLEDLNGYITGQVGLIGTDDNPFSLFQELEASKTPAPIGAGEVAPNDIVIPEGDTGVDPGPFVGELQSVGADARIQEGSIQVLSDSTVLDTGEEVSQELSNVLNELGIEPKEVGLDLRAVFADGVLFEPEELELDIDEYRSDIQAAAGRAFNLSVNADYPTATTAPTMLQSDRGNAKSLALQAAIEDPEVVPDLVSKADAQVRALASQIDDEEALPEELQGVEADVATEEPTDDQDDDTASEDDADADDAAEEADDDDDDDEDAGDALGAMF

Entity 14 Entity 14 polymer

Description description	50S ribosomal protein L10e
Molecular weight formula_weight	19942.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MSDKPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLIVEETVQLRHGSLEASRLSANRHLIKELGEEGDYKMTLRKFPHQVLRENKQATGAGADRVSDGMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKITPSCRIKVERGEELLIA

Entity 15 Entity 15 polymer

Description description	50S ribosomal protein L11
Molecular weight formula_weight	17097.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	I

MAGTIEVLVPGGEANPGPPLGPELGPTPVDVQAVVQEINDQTAAFDGTEVPVTVKYDDDGSFEIEVGVPPTAELIKDEAGFETGSGEPQEDFVADLSVDQVKQIAEQKHPDLLSYDLTNAAKEVVGTCTSLGVTIEGENPREFKERIDAGEYDDVFAAEAQA

Entity 16 Entity 16 polymer

Description description	50S ribosomal protein L13
Molecular weight formula_weight	16249.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	J

MSVAEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFKRTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW

Entity 17 Entity 17 polymer

Description description	50S ribosomal protein L14
Molecular weight formula_weight	14191.2 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	K

MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRLPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPIRRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV

Entity 18 Entity 18 polymer

Description description	50S ribosomal protein L15
Molecular weight formula_weight	18005.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	L

MTSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADDVAEVEDGGFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQAEAEETEDADADEE

Entity 19 Entity 19 polymer

Description description	50S ribosomal protein L15e
Molecular weight formula_weight	22275.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	M

MARSAYSYIRDAWENPGDGQLAELQWQRQQEWRNEGAVERIERPTRLDKARSQGYKAKQGVIVARVSVRKGSARKRRHKAGRRSKRQGVTRITRRKDIQRVAEERASRTFPNLRVLNSYSVGQDGRQKWHEVILIDPNHPAIQNDDDLSWICADDQADRVFRGLTGAGRRNRGLSGKGKGSEKTRPSLRSNGGKG

Entity 20 Entity 20 polymer

Description description	50S ribosomal protein L18
Molecular weight formula_weight	20640.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	N

MATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMPSAYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLYSGDFDAADLPEHFDELRETLLDGDIEL

Entity 21 Entity 21 polymer

Description description	50S ribosomal protein L18e
Molecular weight formula_weight	12438.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	O

MSKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVDFSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR

Entity 22 Entity 22 polymer

Description description	50S ribosomal protein L19e
Molecular weight formula_weight	16796.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	P

MTDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDANHGDA

Entity 23 Entity 23 polymer

Description description	50S ribosomal protein L21e
Molecular weight formula_weight	10567.8 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Q

MPSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE

Entity 24 Entity 24 polymer

Description description	50S ribosomal protein L22
Molecular weight formula_weight	16966.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	R

MGISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGRYPEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEPEVED

Entity 25 Entity 25 polymer

Description description	50S ribosomal protein L23
Molecular weight formula_weight	9612.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	S

MSWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASRIGVF

Entity 26 Entity 26 polymer

Description description	50S ribosomal protein L24
Molecular weight formula_weight	13671.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	T

MSKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTLEKTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA

Entity 27 Entity 27 polymer

Description description	50S ribosomal protein L24e
Molecular weight formula_weight	7233.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	U

PRTRECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTARGEAGEAEDEA

Entity 28 Entity 28 polymer

Description description	50S ribosomal protein L29
Molecular weight formula_weight	7889.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	V

MTVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGDLQENE

Entity 29 Entity 29 polymer

Description description	50S ribosomal protein L30
Molecular weight formula_weight	17062.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	W

MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVDDEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR

Entity 30 Entity 30 polymer

Description description	50S ribosomal protein L31e
Molecular weight formula_weight	10384.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	X

MSASDFEERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEEEGEAIVEAETAE

Entity 31 Entity 31 polymer

Description description	50S ribosomal protein L32e
Molecular weight formula_weight	26455.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Y

MADNEEDVEAEEEYTELTDISGVGPSKAESLREAGFESVEDVRGADQSALADVSGIGNALAARIKADVGGLEVESETEAEVEEEGGEEAPDEDVETELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKGKGDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEVEVSE

Entity 32 Entity 32 polymer

Description description	50S ribosomal protein L37Ae
Molecular weight formula_weight	9409.3 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	Z

RSGRFGARYGRVSRRRVAEIESEMNEDHACPNCGEDRVDRQGTGIWQCSYCDYKFTGGSYKPETPGGKTVRRSIRAALSEDEE

Entity 33 Entity 33 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	117

Entity 34 Entity 34 non-polymer

Description description	POTASSIUM ION
Molecular weight formula_weight	39.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 35 Entity 35 non-polymer

Description description	SODIUM ION
Molecular weight formula_weight	23.0 kDa
Source method src_method	syn
Copy count entity_count	86

Entity 36 Entity 36 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	22

Entity 37 Entity 37 non-polymer

Description description	CADMIUM ION
Molecular weight formula_weight	112.4 kDa
Source method src_method	syn
Copy count entity_count	5

Entity 38 Entity 38 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	7810

▼

6. Fold Classification (SCOP + CATH) 67 domains

SCOP 2.08 (31 domains)

Domain ID domain_id	d1yjw11
Class class	g — Small proteins
Fold Fold fold	g.41 — Rubredoxin-like
Superfamily Superfamily superfamily	g.41.8 — Zn-binding ribosomal proteins
Family Family family	g.41.8.2 — Ribosomal protein L37e

Domain ID domain_id	d1yjw21
Class class	a — All alpha proteins
Fold Fold fold	a.137 — Non-globular all-alpha subunits of globular proteins
Superfamily Superfamily superfamily	a.137.1 — Ribosomal protein L39e
Family Family family	a.137.1.1 — Ribosomal protein L39e

Domain ID domain_id	d1yjw31
Class class	g — Small proteins
Fold Fold fold	g.41 — Rubredoxin-like
Superfamily Superfamily superfamily	g.41.8 — Zn-binding ribosomal proteins
Family Family family	g.41.8.3 — Ribosomal protein L44e

Domain ID domain_id	d1yjwa1
Class class	b — All beta proteins
Fold Fold fold	b.34 — SH3-like barrel
Superfamily Superfamily superfamily	b.34.5 — Translation proteins SH3-like domain
Family Family family	b.34.5.3 — C-terminal domain of ribosomal protein L2

Domain ID domain_id	d1yjwa2
Class class	b — All beta proteins
Fold Fold fold	b.40 — OB-fold
Superfamily Superfamily superfamily	b.40.4 — Nucleic acid-binding proteins
Family Family family	b.40.4.5 — Cold shock DNA-binding domain-like

Domain ID domain_id	d1yjwb1
Class class	b — All beta proteins
Fold Fold fold	b.43 — Reductase/isomerase/elongation factor common domain
Superfamily Superfamily superfamily	b.43.3 — Translation proteins
Family Family family	b.43.3.2 — Ribosomal protein L3

Domain ID domain_id	d1yjwc1
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.22 — Ribosomal protein L4
Superfamily Superfamily superfamily	c.22.1 — Ribosomal protein L4
Family Family family	c.22.1.1 — Ribosomal protein L4

Domain ID domain_id	d1yjwd1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.77 — RL5-like
Superfamily Superfamily superfamily	d.77.1 — RL5-like
Family Family family	d.77.1.1 — Ribosomal protein L5

Domain ID domain_id	d1yjwe1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.141 — Ribosomal protein L6
Superfamily Superfamily superfamily	d.141.1 — Ribosomal protein L6
Family Family family	d.141.1.1 — Ribosomal protein L6

Domain ID domain_id	d1yjwe2
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.141 — Ribosomal protein L6
Superfamily Superfamily superfamily	d.141.1 — Ribosomal protein L6
Family Family family	d.141.1.1 — Ribosomal protein L6

Domain ID domain_id	d1yjwf1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.79 — Bacillus chorismate mutase-like
Superfamily Superfamily superfamily	d.79.3 — L30e-like
Family Family family	d.79.3.1 — L30e/L7ae ribosomal proteins

Domain ID domain_id	d1yjwg1
Class class	j — Peptides
Fold Fold fold	j.84 — Ribosomal protein L10
Superfamily Superfamily superfamily	j.84.1 — Ribosomal protein L10
Family Family family	j.84.1.1 — Ribosomal protein L10

Domain ID domain_id	d1yjwh1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.41 — alpha/beta-Hammerhead
Superfamily Superfamily superfamily	d.41.4 — Ribosomal protein L16p/L10e
Family Family family	d.41.4.1 — Ribosomal protein L10e

Domain ID domain_id	d1yjwi1
Class class	a — All alpha proteins
Fold Fold fold	a.4 — DNA/RNA-binding 3-helical bundle
Superfamily Superfamily superfamily	a.4.7 — Ribosomal protein L11, C-terminal domain
Family Family family	a.4.7.1 — Ribosomal protein L11, C-terminal domain

Domain ID domain_id	d1yjwj1
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.21 — Ribosomal protein L13
Superfamily Superfamily superfamily	c.21.1 — Ribosomal protein L13
Family Family family	c.21.1.1 — Ribosomal protein L13

Domain ID domain_id	d1yjwk1
Class class	b — All beta proteins
Fold Fold fold	b.39 — Ribosomal protein L14
Superfamily Superfamily superfamily	b.39.1 — Ribosomal protein L14
Family Family family	b.39.1.1 — Ribosomal protein L14

Domain ID domain_id	d1yjwl1
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.12 — Ribosomal proteins L15p and L18e
Superfamily Superfamily superfamily	c.12.1 — Ribosomal proteins L15p and L18e
Family Family family	c.12.1.1 — Ribosomal proteins L15p and L18e

Domain ID domain_id	d1yjwm1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.12 — Ribosomal proteins S24e, L23 and L15e
Superfamily Superfamily superfamily	d.12.1 — Ribosomal proteins S24e, L23 and L15e
Family Family family	d.12.1.2 — L15e

Domain ID domain_id	d1yjwn1
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.55 — Ribonuclease H-like motif
Superfamily Superfamily superfamily	c.55.4 — Translational machinery components
Family Family family	c.55.4.1 — Ribosomal protein L18 and S11

Domain ID domain_id	d1yjwo1
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.12 — Ribosomal proteins L15p and L18e
Superfamily Superfamily superfamily	c.12.1 — Ribosomal proteins L15p and L18e
Family Family family	c.12.1.1 — Ribosomal proteins L15p and L18e

Domain ID domain_id	d1yjwp1
Class class	a — All alpha proteins
Fold Fold fold	a.94 — Ribosomal protein L19 (L19e)
Superfamily Superfamily superfamily	a.94.1 — Ribosomal protein L19 (L19e)
Family Family family	a.94.1.1 — Ribosomal protein L19 (L19e)

Domain ID domain_id	d1yjwq1
Class class	b — All beta proteins
Fold Fold fold	b.34 — SH3-like barrel
Superfamily Superfamily superfamily	b.34.5 — Translation proteins SH3-like domain
Family Family family	b.34.5.1 — Ribosomal proteins L24p and L21e

Domain ID domain_id	d1yjwr1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.55 — Ribosomal protein L22
Superfamily Superfamily superfamily	d.55.1 — Ribosomal protein L22
Family Family family	d.55.1.1 — Ribosomal protein L22

Domain ID domain_id	d1yjws1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.12 — Ribosomal proteins S24e, L23 and L15e
Superfamily Superfamily superfamily	d.12.1 — Ribosomal proteins S24e, L23 and L15e
Family Family family	d.12.1.1 — L23p

Domain ID domain_id	d1yjwt1
Class class	b — All beta proteins
Fold Fold fold	b.34 — SH3-like barrel
Superfamily Superfamily superfamily	b.34.5 — Translation proteins SH3-like domain
Family Family family	b.34.5.1 — Ribosomal proteins L24p and L21e

Domain ID domain_id	d1yjwu1
Class class	g — Small proteins
Fold Fold fold	g.39 — Glucocorticoid receptor-like (DNA-binding domain)
Superfamily Superfamily superfamily	g.39.1 — Glucocorticoid receptor-like (DNA-binding domain)
Family Family family	g.39.1.6 — Ribosomal protein L24e

Domain ID domain_id	d1yjwv1
Class class	a — All alpha proteins
Fold Fold fold	a.2 — Long alpha-hairpin
Superfamily Superfamily superfamily	a.2.2 — Ribosomal protein L29 (L29p)
Family Family family	a.2.2.1 — Ribosomal protein L29 (L29p)

Domain ID domain_id	d1yjww1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.59 — Ribosomal protein L30p/L7e
Superfamily Superfamily superfamily	d.59.1 — Ribosomal protein L30p/L7e
Family Family family	d.59.1.1 — Ribosomal protein L30p/L7e

Domain ID domain_id	d1yjwx1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.29 — Ribosomal protein L31e
Superfamily Superfamily superfamily	d.29.1 — Ribosomal protein L31e
Family Family family	d.29.1.1 — Ribosomal protein L31e

Domain ID domain_id	d1yjwy1
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.9 — Barstar-like
Superfamily Superfamily superfamily	c.9.2 — Ribosomal protein L32e
Family Family family	c.9.2.1 — Ribosomal protein L32e

Domain ID domain_id	d1yjwz1
Class class	g — Small proteins
Fold Fold fold	g.41 — Rubredoxin-like
Superfamily Superfamily superfamily	g.41.8 — Zn-binding ribosomal proteins
Family Family family	g.41.8.1 — Ribosomal protein L37ae

CATH v4.4 (36 domains)

Domain ID domain_id	1yjw100
Class class	2 — Mainly Beta
Architecture architecture	20 — Single Sheet
Topology topology	25 — N-terminal domain of TfIIb
Homologous superfamily homologous superfamily	30 —

Domain ID domain_id	1yjw200
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	1620 — Atp Synthase Epsilon Chain; Chain: I;
Homologous superfamily homologous superfamily	10 — Ribosomal protein L39

Domain ID domain_id	1yjw300
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	450 — Nuclear Transport Factor 2; Chain: A,
Homologous superfamily homologous superfamily	80 —

Domain ID domain_id	1yjwA01
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	50 — OB fold (Dihydrolipoamide Acetyltransferase, E2P)
Homologous superfamily homologous superfamily	140 — Nucleic acid-binding proteins

Domain ID domain_id	1yjwA02
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	30 —

Domain ID domain_id	1yjwA03
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	950 — Ribosomal protein L2; domain 3
Homologous superfamily homologous superfamily	10 — Ribosomal protein L2, domain 3

Domain ID domain_id	1yjwB01
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	960 — Ribosomal protein L3; domain 3
Homologous superfamily homologous superfamily	10 — Ribosomal protein L3, domain 3

Domain ID domain_id	1yjwB02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	30 — Elongation Factor Tu (Ef-tu); domain 3
Homologous superfamily homologous superfamily	10 — Translation factors

Domain ID domain_id	1yjwB03
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1430 — Ribosomal Protein L3; Chain: B; domain 2,
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	1yjwC00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1370 — Ribosomal Protein L4; Chain: A;
Homologous superfamily homologous superfamily	10 — Ribosomal protein L4/L1

Domain ID domain_id	1yjwD00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1440 — 50s Ribosomal Protein L5; Chain: A,
Homologous superfamily homologous superfamily	10 — Ribosomal protein L5

Domain ID domain_id	1yjwE01
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	930 — Outer Surface Protein A; domain 3
Homologous superfamily homologous superfamily	12 — Ribosomal protein L6

Domain ID domain_id	1yjwE02
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	930 — Outer Surface Protein A; domain 3
Homologous superfamily homologous superfamily	12 — Ribosomal protein L6

Domain ID domain_id	1yjwF00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1330 — 60s Ribosomal Protein L30; Chain: A;
Homologous superfamily homologous superfamily	30 — Ribosomal protein L30/S12

Domain ID domain_id	1yjwH00
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1170 — Aldehyde Oxidoreductase; domain 3
Homologous superfamily homologous superfamily	10 — Ribosomal protein L16/L10

Domain ID domain_id	1yjwI00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	10 — Arc Repressor Mutant, subunit A
Homologous superfamily homologous superfamily	250 — Ribosomal protein L11/L12, C-terminal domain

Domain ID domain_id	1yjwJ00
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	1180 — Ribosomal Protein L13p; Chain: A;
Homologous superfamily homologous superfamily	10 — Ribosomal protein L13

Domain ID domain_id	1yjwK00
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	150 — Ribosomal Protein L14
Homologous superfamily homologous superfamily	20 — Ribosomal protein L14/L23

Domain ID domain_id	1yjwL01
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	990 — Molecule: Ribosomal Protein L15; Chain: K; domain 1
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	1yjwL02
Class class	3 — Alpha Beta
Architecture architecture	100 — Ribosomal Protein L15; Chain: K; domain 2
Topology topology	10 — Ribosomal Protein L15; Chain: K; domain 2
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	1yjwM00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	1120 — Ribosomal protein L15e
Homologous superfamily homologous superfamily	10 — Ribosomal protein L15

Domain ID domain_id	1yjwN00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	420 — Nucleotidyltransferase; domain 5
Homologous superfamily homologous superfamily	100 —

Domain ID domain_id	1yjwO00
Class class	3 — Alpha Beta
Architecture architecture	100 — Ribosomal Protein L15; Chain: K; domain 2
Topology topology	10 — Ribosomal Protein L15; Chain: K; domain 2
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	1yjwP01
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	1650 — 50s Ribosomal Protein L19e, Chain O, domain 1
Homologous superfamily homologous superfamily	10 —

Domain ID domain_id	1yjwP02
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	560 — Single Heli x bin

Domain ID domain_id	1yjwP03
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	1200 — Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A
Homologous superfamily homologous superfamily	60 —

Domain ID domain_id	1yjwQ00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	70 — Ribosomal protein L21

Domain ID domain_id	1yjwR00
Class class	3 — Alpha Beta
Architecture architecture	90 — Alpha-Beta Complex
Topology topology	470 — Ribosomal Protein L22; Chain A
Homologous superfamily homologous superfamily	10 — Ribosomal protein L22/L17

Domain ID domain_id	1yjwS00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	70 — Alpha-Beta Plaits
Homologous superfamily homologous superfamily	330 — RRM (RNA recognition motif) domain

Domain ID domain_id	1yjwT00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	30 — SH3 type barrels.
Homologous superfamily homologous superfamily	30 —

Domain ID domain_id	1yjwU00
Class class	2 — Mainly Beta
Architecture architecture	30 — Roll
Topology topology	170 — Ribosomal Protein L24e; Chain: T;
Homologous superfamily homologous superfamily	20 — Ribosomal protein L24

Domain ID domain_id	1yjwV00
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	310 —

Domain ID domain_id	1yjwW01
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	1390 — Ribosomal Protein L30; Chain: A,
Homologous superfamily homologous superfamily	20 — Ribosomal protein L30/L7

Domain ID domain_id	1yjwW02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	15 — 3-methyladenine DNA Glycosylase II; Chain A, domain 3
Homologous superfamily homologous superfamily	30 — Ribosomal protein L30/L7, central domain

Domain ID domain_id	1yjwX00
Class class	3 — Alpha Beta
Architecture architecture	10 — Roll
Topology topology	440 — Ribosomal Protein L31e; Chain: W;
Homologous superfamily homologous superfamily	10 — Ribosomal protein L31

Domain ID domain_id	1yjwZ00
Class class	2 — Mainly Beta
Architecture architecture	20 — Single Sheet
Topology topology	25 — N-terminal domain of TfIIb
Homologous superfamily homologous superfamily	30 —

▶

Unit-cell length a length_a	211.690 Å
Unit-cell length b length_b	299.779 Å
Unit-cell length c length_c	573.885 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	C 2 2 21
Space-group number int_tables_number	20
Crystal system crystal_system	—

Resolution resolution	2.900 Å
Low-resolution limit resolution_low	29.980 Å
R factor r_factor	0.1710
R_work r_work	0.1710
R_free r_free	0.2230

Crystal Structure Of Quinupristin Bound To The G2099A Mutant 50S Ribosomal Subunit Of Haloarcula Marismortui

1. Protein Identity and Related Structures Protein Identity & Related Structures

50S ribosomal protein L37e

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

50S ribosomal protein L39e

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

50S ribosomal protein L44e

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

50S ribosomal protein L2

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

50S ribosomal protein L3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

50S ribosomal protein L4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

50S ribosomal protein L5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

50S ribosomal protein L6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

50S ribosomal protein L7Ae

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

50S ribosomal protein L10

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer