SAXSdb — 1zni

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

INSULIN

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein homooligomer	Homooligomer	Protein 2	ZINC ION × 2 CHLORIDE ION × 3 water × 2	Consistent with protein count
2	Protein homooligomer	Homooligomer	Protein 2	ZINC ION × 1 water × 2	Consistent with protein count
3	Protein homooligomer	Homooligomer	Protein 12	ZINC ION × 9 CHLORIDE ION × 9 water × 12	Consistent with protein count
4	Protein homooligomer	Homooligomer	Protein 12	ZINC ION × 9 CHLORIDE ION × 9 water × 12	Consistent with protein count
5	Protein homooligomer	Homooligomer	Protein 4	ZINC ION × 3 CHLORIDE ION × 3 water × 4	Consistent with protein count
6	Protein homooligomer	Homooligomer	Protein 4	ZINC ION × 3 CHLORIDE ION × 3 water × 4	Consistent with protein count
7	Protein homooligomer	Homooligomer	Protein 6	ZINC ION × 6 CHLORIDE ION × 9 water × 6	Consistent with protein count
8	Protein homooligomer	Homooligomer	Protein 6	ZINC ION × 3 water × 6	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	INS_PIG
Isoform	—
PDB entities	1, 2
Chains and sequence ranges	Author chain A； PDBConstruct 1–21； UniProt 88–108 Author chain C； PDBConstruct 1–21； UniProt 88–108 Author chain B； PDBConstruct 1–30； UniProt 25–54 Author chain D； PDBConstruct 1–30； UniProt 25–54

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	1zni
Deposition date deposition_date	1997-09-23
Structure title title	INSULIN
Keywords keywords	HORMONE, GLUCOSE METABOLISM; HORMONE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

1zni__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

1zni__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

1zni__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	11.76 Å
Rg (electron density)	10.74 Å
Total Rg	11.99 Å
Atom count	408
Residues	51
Excluded volume	7309 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`1zni__assembly_1__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`1zni__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`1zni__assembly_3__model_1`	dodecameric （12）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`1zni__assembly_4__model_1`	dodecameric （12）	Success	4.1.3-1-20251215 (887e7ef)	View Download
5	1	`1zni__assembly_5__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
6	1	`1zni__assembly_6__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
7	1	`1zni__assembly_7__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download
8	1	`1zni__assembly_8__model_1`	hexameric （6）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Description description	INSULIN
Molecular weight formula_weight	2383.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C
Atom count atom_count	929

GIVEQCCTSICSLYQLENYCN

Entity 2 Entity 2 polymer

Description description	INSULIN
Molecular weight formula_weight	3403.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D

FVNQHLCGSHLVEALYLVCGERGFFYTPKA

Entity 3 Entity 3 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 4 Entity 4 non-polymer

Description description	CHLORIDE ION
Molecular weight formula_weight	35.5 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 5 Entity 5 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	103

▼

6. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (2 domains)

Domain ID domain_id	d1zni.1
Class class	g — Small proteins
Fold Fold fold	g.1 — Insulin-like
Superfamily Superfamily superfamily	g.1.1 — Insulin-like
Family Family family	g.1.1.1 — Insulin-like

Domain ID domain_id	d1zni.2
Class class	g — Small proteins
Fold Fold fold	g.1 — Insulin-like
Superfamily Superfamily superfamily	g.1.1 — Insulin-like
Family Family family	g.1.1.1 — Insulin-like

▶

7. Citations (9)

Structure of insulin in 4-zinc insulin.

Nature (1976)

PMID: 1272390 · DOI: 10.1038/261166a0 PRIMARY

The Structure of a Rhombohedral R6 Insulin Hexamer that Binds Phenol

Biopolymers (1992)

Role of B13 Glu in Insulin Assembly. The Hexamer Structure of Recombinant Mutant (B13 Glu-->Gln) Insulin

J.Mol.Biol. (1992)

X-Ray Analysis of the Single Chain B29-A1 Peptide-Linked Insulin Molecule. A Completely Inactive Analogue

J.Mol.Biol. (1991)

Phenol Stabilizes More Helix in a New Symmetrical Zinc Insulin Hexamer

Nature (1989)

Comparison of Solution Structural Flexibility and Zinc Binding Domains for Insulin, Proinsulin, and Miniproinsulin

Biochemistry (1989)

The Structure of 2Zn Pig Insulin Crystals at 1.5 A Resolution

Philos.Trans.R.Soc.London,Ser.B (1988)

Structural Stability in the 4-Zinc Human Insulin Hexamer

Proc.Natl.Acad.Sci.USA (1984)

Rhombohedral Insulin Crystal Transformation

J.Mol.Biol. (1978)

Unit-cell length a length_a	80.700 Å
Unit-cell length b length_b	80.700 Å
Unit-cell length c length_c	37.600 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	18

Space group space_group	H 3
Space-group number int_tables_number	146
Crystal system crystal_system	—

Resolution resolution	1.498 Å
Low-resolution limit resolution_low	40.000 Å
R factor r_factor	—
R_work r_work	0.1780
R_free r_free	—

INSULIN

1. Protein Identity and Related Structures Protein Identity & Related Structures

INSULIN

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1zni__assembly_1__model_1

1zni__assembly_1__model_1 | I(q)

1zni__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (2 domains)

7. Citations (9)

INSULIN

1. Protein Identity and Related Structures Protein Identity & Related Structures

INSULIN

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

1zni__assembly_1__model_1

1zni__assembly_1__model_1 | I(q)

1zni__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (5)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 water

6. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (2 domains)

7. Citations (9)