SAXSdb — 7ins

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

INSULIN (CHAIN A)

Sus scrofa

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	GENERAL PROTAMINE CHAIN × 1 M-CRESOL × 1 water × 3	Consistent with protein count
10	Protein heterocomplex	Heteromer	Protein 4	GENERAL PROTAMINE CHAIN × 1 ZINC ION × 1 UNKNOWN LIGAND × 2 water × 4	Consistent with protein count
11	Protein homooligomer	Homooligomer	Protein 4	M-CRESOL × 2 ZINC ION × 2 UNKNOWN LIGAND × 4 water × 4	Consistent with protein count
12	Protein homooligomer	Homooligomer	Protein 2	M-CRESOL × 1 water × 2	Consistent with protein count
2	Protein homooligomer	Homooligomer	Protein 2	M-CRESOL × 1 ZINC ION × 1 UNKNOWN LIGAND × 2 water × 2	Consistent with protein count
3	Protein homooligomer	Homooligomer	Protein 2	M-CRESOL × 1 water × 2	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 14	GENERAL PROTAMINE CHAIN × 2 M-CRESOL × 6 ZINC ION × 2 UNKNOWN LIGAND × 4 water × 14	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 7	GENERAL PROTAMINE CHAIN × 1 M-CRESOL × 3 ZINC ION × 1 UNKNOWN LIGAND × 2 water × 7	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 10	GENERAL PROTAMINE CHAIN × 2 M-CRESOL × 4 ZINC ION × 2 UNKNOWN LIGAND × 4 water × 10	Consistent with protein count
7	Protein homooligomer	Homooligomer	Protein 4	M-CRESOL × 2 water × 4	Consistent with protein count
8	Protein heterocomplex	Heteromer	Protein 8	GENERAL PROTAMINE CHAIN × 2 ZINC ION × 2 UNKNOWN LIGAND × 4 water × 8	Consistent with protein count
9	Protein homooligomer	Homooligomer	Protein 4	M-CRESOL × 2 ZINC ION × 1 UNKNOWN LIGAND × 2 water × 4	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	INS_PIG
Isoform	—
PDB entities	1, 2
Chains and sequence ranges	Author chain A； PDBConstruct 1–21； UniProt 88–108 Author chain C； PDBConstruct 1–21； UniProt 88–108 Author chain E； PDBConstruct 1–21； UniProt 88–108 Author chain B； PDBConstruct 1–30； UniProt 25–54 Author chain D； PDBConstruct 1–30； UniProt 25–54 Author chain F； PDBConstruct 1–30； UniProt 25–54

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	7ins
Deposition date deposition_date	1991-09-03
Structure title title	STRUCTURE OF PORCINE INSULIN COCRYSTALLIZED WITH CLUPEINE Z
Keywords keywords	HORMONE; HORMONE
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

7ins__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

7ins__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

7ins__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	13.33 Å
Rg (electron density)	11.95 Å
Total Rg	13.11 Å
Atom count	535
Residues	67
Excluded volume	9133 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`7ins__assembly_1__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`7ins__assembly_2__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`7ins__assembly_3__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`7ins__assembly_4__model_1`	tetradecameric （14）	Success	4.1.3-1-20251215 (887e7ef)	View Download
5	1	`7ins__assembly_5__model_1`	heptameric （7）	Success	4.1.3-1-20251215 (887e7ef)	View Download
6	1	`7ins__assembly_6__model_1`	decameric （10）	Success	4.1.3-1-20251215 (887e7ef)	View Download
7	1	`7ins__assembly_7__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
8	1	`7ins__assembly_8__model_1`	octameric （8）	Success	4.1.3-1-20251215 (887e7ef)	View Download
9	1	`7ins__assembly_9__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
10	1	`7ins__assembly_10__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
11	1	`7ins__assembly_11__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download
12	1	`7ins__assembly_12__model_1`	dimeric （2）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Description description	INSULIN (CHAIN A)
Molecular weight formula_weight	2383.7 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,C,E
Atom count atom_count	1492

GIVEQCCTSICSLYQLENYCN

Source Source

Source organism organism	Sus scrofa
Common name common_name	pig
NCBI taxonomy ID ncbi_taxonomy_id	9823

Entity 2 Entity 2 polymer

Description description	INSULIN (CHAIN B)
Molecular weight formula_weight	3403.9 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,D,F

FVNQHLCGSHLVEALYLVCGERGFFYTPKA

Source Source

Source organism organism	Sus scrofa
Common name common_name	pig
NCBI taxonomy ID ncbi_taxonomy_id	9823

Entity 3 Entity 3 polymer

Description description	GENERAL PROTAMINE CHAIN
Molecular weight formula_weight	1379.7 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

XXXXXXXXXXXXXXXX

Entity 4 Entity 4 non-polymer

Description description	M-CRESOL
Molecular weight formula_weight	108.1 kDa
Source method src_method	syn
Copy count entity_count	3

Entity 5 Entity 5 non-polymer

Description description	ZINC ION
Molecular weight formula_weight	65.4 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 6 Entity 6 non-polymer

Description description	UNKNOWN LIGAND
Molecular weight formula_weight	103.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 7 Entity 7 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	109

▼

6. Fold Classification (SCOP + CATH) 3 domains

SCOP 2.08 (3 domains)

Domain ID domain_id	d7ins.1
Class class	g — Small proteins
Fold Fold fold	g.1 — Insulin-like
Superfamily Superfamily superfamily	g.1.1 — Insulin-like
Family Family family	g.1.1.1 — Insulin-like

Domain ID domain_id	d7ins.2
Class class	g — Small proteins
Fold Fold fold	g.1 — Insulin-like
Superfamily Superfamily superfamily	g.1.1 — Insulin-like
Family Family family	g.1.1.1 — Insulin-like

Domain ID domain_id	d7ins.3
Class class	g — Small proteins
Fold Fold fold	g.1 — Insulin-like
Superfamily Superfamily superfamily	g.1.1 — Insulin-like
Family Family family	g.1.1.1 — Insulin-like

▶

Unit-cell length a length_a	62.900 Å
Unit-cell length b length_b	62.900 Å
Unit-cell length c length_c	85.900 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	24

Space group space_group	P 43 21 2
Space-group number int_tables_number	96
Crystal system crystal_system	—

Resolution resolution	2.000 Å
Low-resolution limit resolution_low	— Å
R factor r_factor	0.1940
R_work r_work	—
R_free r_free	—

STRUCTURE OF PORCINE INSULIN COCRYSTALLIZED WITH CLUPEINE Z

1. Protein Identity and Related Structures Protein Identity & Related Structures

INSULIN (CHAIN A)

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7ins__assembly_1__model_1

7ins__assembly_1__model_1 | I(q)

7ins__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 water

6. Fold Classification (SCOP + CATH) 3 domains

SCOP 2.08 (3 domains)

7. Citations (3)

STRUCTURE OF PORCINE INSULIN COCRYSTALLIZED WITH CLUPEINE Z

1. Protein Identity and Related Structures Protein Identity & Related Structures

INSULIN (CHAIN A)

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

7ins__assembly_1__model_1

7ins__assembly_1__model_1 | I(q)

7ins__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (7)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 water

6. Fold Classification (SCOP + CATH) 3 domains

SCOP 2.08 (3 domains)

7. Citations (3)