SAXSdb — 24nd

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Reverse transcriptase domain-containing protein

Enterobacteriaceae

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Homooligomer	Protein 6 RNA 1	;RNA (5'-R(PUPUPGPU)-3') ; × 1 2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE × 6 MAGNESIUM ION × 12	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	A0A628R156_SALMU
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–540； UniProt 1–540 Author chain B； PDBConstruct 1–540； UniProt 1–540 Author chain C； PDBConstruct 1–540； UniProt 1–540 Author chain D； PDBConstruct 1–540； UniProt 1–540 Author chain E； PDBConstruct 1–540； UniProt 1–540 Author chain F； PDBConstruct 1–540； UniProt 1–540

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	24nd
Deposition date deposition_date	2026-03-11
Structure title title	DRT4 homohexamer with dGTP, ssRNA (local refinement)
Keywords keywords	DRT4; reverse transcriptase; terminal transferase; nuclease, IMMUNE SYSTEM; IMMUNE SYSTEM
Experimental Method method	ELECTRON MICROSCOPY

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

24nd__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

24nd__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

24nd__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	46.53 Å
Rg (electron density)	45.82 Å
Total Rg	46.00 Å
Atom count	25339
Residues	3059
Excluded volume	449270 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`24nd__assembly_1__model_1`	heptameric （7）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	Reverse transcriptase domain-containing protein
Molecular weight formula_weight	62851.0 kDa
Source method src_method	man
Copy count entity_count	6

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C,D,E,F
Atom count atom_count	25339

MVIFDEKRHLYEALLRHNYFPNQKGSISEIPPCFSSRTFTPEIAELISSDTSGRRSLQGYDCVEYYATRYNNFPRTLSIIHPKAYSKLAKHIHDNWEEIRFIKENENSMIKPDMHADGRIIIMNYEDAETKTIRELNDGFGRRFKVNADISGCFTNIYSHSIPWAVIGVNNAKIALNTKVKNQDKHWSDKLDYFQRQAKRNETHGVPIGPATSSIVCEIILSAVDKRLRDDGFLFRRYIDDYTCYCKTHDDAKEFLHLLGMELSKYKLSLNLHKTKITNLPGTLNDNWVSLLNVNSPTKKRFTDQDLNKLSSSEVINFLDYAVQLNTQVGGGSILKYAISLVINNLDEYTITQVYDYLLNLSWHYPMLIPYLGVLIEHVYLDDGDEYKNKFNEILSMCAENKCSDGMAWTLYFCIKNNIDIDDDVIEKIICFGDCLSLCLLDSSDIYEEKINNFVSDIIKLDYEYDIDRYWLLFYQRFFKDKAPSPYNDKCFDIMKGYGVDFMPDENYKTKAESYCHVVNNPFLEDGDEIVSFNDYMAIA

Source Source

Source organism organism	Enterobacteriaceae
Common name common_name	enterobacteria
NCBI taxonomy ID ncbi_taxonomy_id	543
Host organism host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	;RNA (5'-R(PUPUPGPU)-3') ;
Molecular weight formula_weight	3055.7 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	G

UUUGUUUUUU

Entity 3 Entity 3 non-polymer

Description description	2'-DEOXYGUANOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	507.2 kDa
Source method src_method	syn
Copy count entity_count	6

Entity 4 Entity 4 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	12

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	—

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

Resolution resolution	2.680 Å
Low-resolution limit resolution_low	— Å
R factor r_factor	—
R_work r_work	—
R_free r_free	—

Resolution resolution	2.68 Å
Resolution测定Method resolution_method	—
颗粒数 num_particles	132315

DRT4 homohexamer with dGTP, ssRNA (local refinement)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Reverse transcriptase domain-containing protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

24nd__assembly_1__model_1

24nd__assembly_1__model_1 | I(q)

24nd__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

7. Citations (1)

DRT4 homohexamer with dGTP, ssRNA (local refinement)

1. Protein Identity and Related Structures Protein Identity & Related Structures

Reverse transcriptase domain-containing protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

24nd__assembly_1__model_1

24nd__assembly_1__model_1 | I(q)

24nd__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

冷冻电镜 EM 3D

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

7. Citations (1)