SAXSdb — 2bu1

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

MS2 COAT PROTEIN

BACTERIOPHAGE MS2

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Homooligomer	Protein 180 RNA 120	;5'-R(APCPAPUPGPAPGPGPAPUP 5BUAPCPCPCPAPUPGP*U)-3' ; × 120 water × 240	Consistent with all polymers
2	Protein–RNA	Homooligomer	Protein 3 RNA 2	;5'-R(APCPAPUPGPAPGPGPAPUP 5BUAPCPCPCPAPUPGP*U)-3' ; × 2 water × 4	Consistent with all polymers
3	Protein–RNA	Homooligomer	Protein 15 RNA 10	;5'-R(APCPAPUPGPAPGPGPAPUP 5BUAPCPCPCPAPUPGP*U)-3' ; × 10 water × 20	Consistent with all polymers
4	Protein–RNA	Homooligomer	Protein 18 RNA 12	;5'-R(APCPAPUPGPAPGPGPAPUP 5BUAPCPCPCPAPUPGP*U)-3' ; × 12 water × 24	Consistent with all polymers
5	Protein–RNA	Homooligomer	Protein 3 RNA 2	;5'-R(APCPAPUPGPAPGPGPAPUP 5BUAPCPCPCPAPUPGP*U)-3' ; × 2 water × 4	Consistent with all polymers
6	Protein–RNA	Homooligomer	Protein 30 RNA 20	;5'-R(APCPAPUPGPAPGPGPAPUP 5BUAPCPCPCPAPUPGP*U)-3' ; × 20 water × 40	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	COAT_BPMS2
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–129； UniProt 1–129 Author chain B； PDBConstruct 1–129； UniProt 1–129 Author chain C； PDBConstruct 1–129； UniProt 1–129

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2bu1
Deposition date deposition_date	2005-06-08
Structure title title	MS2-RNA HAIRPIN (5BRU -5) COMPLEX
Keywords keywords	;VIRUS/RNA, COMPLEX (CAPSID PROTEIN-RNA HAIRPIN), HAIRPIN, CAPSID, LEVIVIRUS, CAPSID PROTEIN, RNA-BINDING, STRUCTURAL PROTEIN, ICOSAHEDRAL VIRUS, VIRUS-RNA complex ;; VIRUS/RNA
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2bu1__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2bu1__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2bu1__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	0.00 Å
Rg (electron density)	118.40 Å
Total Rg	118.10 Å
Atom count	217380
Residues	25140
Excluded volume	3709500 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2bu1__assembly_1__model_1`	300-MERIC （300）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`2bu1__assembly_2__model_1`	pentameric （5）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
3	1	`2bu1__assembly_3__model_1`	25-meric （25）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
4	1	`2bu1__assembly_4__model_1`	30-meric （30）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
5	1	`2bu1__assembly_5__model_1`	pentameric （5）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.
6	1	`2bu1__assembly_6__model_1`	50-meric （50）	Excluded	—	—
	Exclusion reason： Auxiliary symmetry representation; not a complete or representative biological assembly.

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	MS2 COAT PROTEIN
Molecular weight formula_weight	13738.5 kDa
Source method src_method	man
Copy count entity_count	3

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,C
Atom count atom_count	3828

ASNFTQFVLVDNGGTGDVTVAPSNFANGVAEWISSNSRSQAYKVTCSVRQSSAQNRKYTIKVEVPKVATQTVGGVELPVAAWRSYLNMELTIPIFATNSDCELIVKAMQGLLKDGNPIPSAIAANSGIY

Source Source

Source organism organism	BACTERIOPHAGE MS2
NCBI taxonomy ID ncbi_taxonomy_id	12022
Host organism host_organism	ESCHERICHIA COLI

Entity 2 Entity 2 polymer

Description description	;5'-R(APCPAPUPGPAPGPGPAPUP 5BUAPCPCPCPAPUPGP*U)-3' ;
Molecular weight formula_weight	6141.6 kDa
Source method src_method	syn
Copy count entity_count	2

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	R,S

ACAUGAGGAUUACCCAUGU

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	205

▼

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (3 domains)

Domain ID domain_id	d2bu1a_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.85 — RNA bacteriophage capsid protein
Superfamily Superfamily superfamily	d.85.1 — RNA bacteriophage capsid protein
Family Family family	d.85.1.1 — RNA bacteriophage capsid protein

Domain ID domain_id	d2bu1b_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.85 — RNA bacteriophage capsid protein
Superfamily Superfamily superfamily	d.85.1 — RNA bacteriophage capsid protein
Family Family family	d.85.1.1 — RNA bacteriophage capsid protein

Domain ID domain_id	d2bu1c_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.85 — RNA bacteriophage capsid protein
Superfamily Superfamily superfamily	d.85.1 — RNA bacteriophage capsid protein
Family Family family	d.85.1.1 — RNA bacteriophage capsid protein

CATH v4.4 (3 domains)

Domain ID domain_id	2bu1A00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	380 — MS2 Viral Coat Protein
Homologous superfamily homologous superfamily	10 — MS2 Viral Coat Protein

Domain ID domain_id	2bu1B00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	380 — MS2 Viral Coat Protein
Homologous superfamily homologous superfamily	10 — MS2 Viral Coat Protein

Domain ID domain_id	2bu1C00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	380 — MS2 Viral Coat Protein
Homologous superfamily homologous superfamily	10 — MS2 Viral Coat Protein

▶

Unit-cell length a length_a	288.000 Å
Unit-cell length b length_b	288.000 Å
Unit-cell length c length_c	653.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	540

Space group space_group	H 3 2
Space-group number int_tables_number	155
Crystal system crystal_system	—

Resolution resolution	2.200 Å
Low-resolution limit resolution_low	47.000 Å
R factor r_factor	0.2190
R_work r_work	0.2190
R_free r_free	0.2440

MS2-RNA HAIRPIN (5BRU -5) COMPLEX

1. Protein Identity and Related Structures Protein Identity & Related Structures

MS2 COAT PROTEIN

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2bu1__assembly_1__model_1

2bu1__assembly_1__model_1 | I(q)

2bu1__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (3 domains)

CATH v4.4 (3 domains)

7. Citations (1)

MS2-RNA HAIRPIN (5BRU -5) COMPLEX

1. Protein Identity and Related Structures Protein Identity & Related Structures

MS2 COAT PROTEIN

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2bu1__assembly_1__model_1

2bu1__assembly_1__model_1 | I(q)

2bu1__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 water

6. Fold Classification (SCOP + CATH) 6 domains

SCOP 2.08 (3 domains)

CATH v4.4 (3 domains)

7. Citations (1)