2d2c

Crystal Structure Of Cytochrome B6F Complex with DBMIB From M. Laminosus

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cytochrome b6

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Cytochrome b6-f complex subunit 4 × 2 （P83792） Apocytochrome f × 2 （P83793） Cytochrome b6-f complex iron-sulfur subunit × 2 （P83794） Cytochrome b6-f complex subunit VI × 2 （P83795） Cytochrome b6-f complex subunit VII × 2 （P83796） Cytochrome b6-f complex subunit V × 2 （P83797） Cytochrome b6-f complex subunit VIII × 2 （P83798） HEME C × 8 (7R,17E)-4-HYDROXY-N,N,N,7-TETRAMETHYL-7-[(8E)-OCTADEC-8-ENOYLOXY]-10-OXO-3,5,9-TRIOXA-4-PHOSPHAHEPTACOS-17-EN-1-AMINIUM 4-OXIDE × 4 2,5-DIBROMO-3-ISOPROPYL-6-METHYLBENZO-1,4-QUINONE × 2 CHLOROPHYLL A × 2 FE2/S2 (INORGANIC) CLUSTER × 2 BETA-CAROTENE × 2 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CYB6_MASLA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–215； UniProt 1–215 Author chain N； PDBConstruct 1–215； UniProt 1–215

Cytochrome b6-f complex subunit 4

OrganismNot specified

UniProt P83792

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Cytochrome b6 × 2 （P83791） Apocytochrome f × 2 （P83793） Cytochrome b6-f complex iron-sulfur subunit × 2 （P83794） Cytochrome b6-f complex subunit VI × 2 （P83795） Cytochrome b6-f complex subunit VII × 2 （P83796） Cytochrome b6-f complex subunit V × 2 （P83797） Cytochrome b6-f complex subunit VIII × 2 （P83798） HEME C × 8 (7R,17E)-4-HYDROXY-N,N,N,7-TETRAMETHYL-7-[(8E)-OCTADEC-8-ENOYLOXY]-10-OXO-3,5,9-TRIOXA-4-PHOSPHAHEPTACOS-17-EN-1-AMINIUM 4-OXIDE × 4 2,5-DIBROMO-3-ISOPROPYL-6-METHYLBENZO-1,4-QUINONE × 2 CHLOROPHYLL A × 2 FE2/S2 (INORGANIC) CLUSTER × 2 BETA-CAROTENE × 2 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PETD_MASLA
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–160； UniProt 1–160 Author chain O； PDBConstruct 1–160； UniProt 1–160

Apocytochrome f

OrganismNot specified

UniProt P83793

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Cytochrome b6 × 2 （P83791） Cytochrome b6-f complex subunit 4 × 2 （P83792） Cytochrome b6-f complex iron-sulfur subunit × 2 （P83794） Cytochrome b6-f complex subunit VI × 2 （P83795） Cytochrome b6-f complex subunit VII × 2 （P83796） Cytochrome b6-f complex subunit V × 2 （P83797） Cytochrome b6-f complex subunit VIII × 2 （P83798） HEME C × 8 (7R,17E)-4-HYDROXY-N,N,N,7-TETRAMETHYL-7-[(8E)-OCTADEC-8-ENOYLOXY]-10-OXO-3,5,9-TRIOXA-4-PHOSPHAHEPTACOS-17-EN-1-AMINIUM 4-OXIDE × 4 2,5-DIBROMO-3-ISOPROPYL-6-METHYLBENZO-1,4-QUINONE × 2 CHLOROPHYLL A × 2 FE2/S2 (INORGANIC) CLUSTER × 2 BETA-CAROTENE × 2 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CYF_MASLA
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–289； UniProt 1–289 Author chain P； PDBConstruct 1–289； UniProt 1–289

Cytochrome b6-f complex iron-sulfur subunit

OrganismNot specified

UniProt P83794

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Cytochrome b6 × 2 （P83791） Cytochrome b6-f complex subunit 4 × 2 （P83792） Apocytochrome f × 2 （P83793） Cytochrome b6-f complex subunit VI × 2 （P83795） Cytochrome b6-f complex subunit VII × 2 （P83796） Cytochrome b6-f complex subunit V × 2 （P83797） Cytochrome b6-f complex subunit VIII × 2 （P83798） HEME C × 8 (7R,17E)-4-HYDROXY-N,N,N,7-TETRAMETHYL-7-[(8E)-OCTADEC-8-ENOYLOXY]-10-OXO-3,5,9-TRIOXA-4-PHOSPHAHEPTACOS-17-EN-1-AMINIUM 4-OXIDE × 4 2,5-DIBROMO-3-ISOPROPYL-6-METHYLBENZO-1,4-QUINONE × 2 CHLOROPHYLL A × 2 FE2/S2 (INORGANIC) CLUSTER × 2 BETA-CAROTENE × 2 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	UCRI_MASLA
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–179； UniProt 1–179 Author chain Q； PDBConstruct 1–179； UniProt 1–179

Cytochrome b6-f complex subunit VI

OrganismNot specified

UniProt P83795

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Cytochrome b6 × 2 （P83791） Cytochrome b6-f complex subunit 4 × 2 （P83792） Apocytochrome f × 2 （P83793） Cytochrome b6-f complex iron-sulfur subunit × 2 （P83794） Cytochrome b6-f complex subunit VII × 2 （P83796） Cytochrome b6-f complex subunit V × 2 （P83797） Cytochrome b6-f complex subunit VIII × 2 （P83798） HEME C × 8 (7R,17E)-4-HYDROXY-N,N,N,7-TETRAMETHYL-7-[(8E)-OCTADEC-8-ENOYLOXY]-10-OXO-3,5,9-TRIOXA-4-PHOSPHAHEPTACOS-17-EN-1-AMINIUM 4-OXIDE × 4 2,5-DIBROMO-3-ISOPROPYL-6-METHYLBENZO-1,4-QUINONE × 2 CHLOROPHYLL A × 2 FE2/S2 (INORGANIC) CLUSTER × 2 BETA-CAROTENE × 2 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PETL_MASLA
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–32； UniProt 1–32 Author chain R； PDBConstruct 1–32； UniProt 1–32

Cytochrome b6-f complex subunit VII

OrganismNot specified

UniProt P83796

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Cytochrome b6 × 2 （P83791） Cytochrome b6-f complex subunit 4 × 2 （P83792） Apocytochrome f × 2 （P83793） Cytochrome b6-f complex iron-sulfur subunit × 2 （P83794） Cytochrome b6-f complex subunit VI × 2 （P83795） Cytochrome b6-f complex subunit V × 2 （P83797） Cytochrome b6-f complex subunit VIII × 2 （P83798） HEME C × 8 (7R,17E)-4-HYDROXY-N,N,N,7-TETRAMETHYL-7-[(8E)-OCTADEC-8-ENOYLOXY]-10-OXO-3,5,9-TRIOXA-4-PHOSPHAHEPTACOS-17-EN-1-AMINIUM 4-OXIDE × 4 2,5-DIBROMO-3-ISOPROPYL-6-METHYLBENZO-1,4-QUINONE × 2 CHLOROPHYLL A × 2 FE2/S2 (INORGANIC) CLUSTER × 2 BETA-CAROTENE × 2 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PETM_MASLA
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–35； UniProt 1–35 Author chain S； PDBConstruct 1–35； UniProt 1–35

Cytochrome b6-f complex subunit V

OrganismNot specified

UniProt P83797

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Cytochrome b6 × 2 （P83791） Cytochrome b6-f complex subunit 4 × 2 （P83792） Apocytochrome f × 2 （P83793） Cytochrome b6-f complex iron-sulfur subunit × 2 （P83794） Cytochrome b6-f complex subunit VI × 2 （P83795） Cytochrome b6-f complex subunit VII × 2 （P83796） Cytochrome b6-f complex subunit VIII × 2 （P83798） HEME C × 8 (7R,17E)-4-HYDROXY-N,N,N,7-TETRAMETHYL-7-[(8E)-OCTADEC-8-ENOYLOXY]-10-OXO-3,5,9-TRIOXA-4-PHOSPHAHEPTACOS-17-EN-1-AMINIUM 4-OXIDE × 4 2,5-DIBROMO-3-ISOPROPYL-6-METHYLBENZO-1,4-QUINONE × 2 CHLOROPHYLL A × 2 FE2/S2 (INORGANIC) CLUSTER × 2 BETA-CAROTENE × 2 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PETG_MASLA
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–37； UniProt 1–37 Author chain T； PDBConstruct 1–37； UniProt 1–37

Cytochrome b6-f complex subunit VIII

OrganismNot specified

UniProt P83798

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Cytochrome b6 × 2 （P83791） Cytochrome b6-f complex subunit 4 × 2 （P83792） Apocytochrome f × 2 （P83793） Cytochrome b6-f complex iron-sulfur subunit × 2 （P83794） Cytochrome b6-f complex subunit VI × 2 （P83795） Cytochrome b6-f complex subunit VII × 2 （P83796） Cytochrome b6-f complex subunit V × 2 （P83797） HEME C × 8 (7R,17E)-4-HYDROXY-N,N,N,7-TETRAMETHYL-7-[(8E)-OCTADEC-8-ENOYLOXY]-10-OXO-3,5,9-TRIOXA-4-PHOSPHAHEPTACOS-17-EN-1-AMINIUM 4-OXIDE × 4 2,5-DIBROMO-3-ISOPROPYL-6-METHYLBENZO-1,4-QUINONE × 2 CHLOROPHYLL A × 2 FE2/S2 (INORGANIC) CLUSTER × 2 BETA-CAROTENE × 2 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PETN_MASLA
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–29； UniProt 1–29 Author chain U； PDBConstruct 1–29； UniProt 1–29

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2d2c
Deposition date deposition_date	2005-09-07
Structure title title	Crystal Structure Of Cytochrome B6F Complex with DBMIB From M. Laminosus
Keywords keywords	Photosynthesis; PHOTOSYNTHESIS
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2d2c__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2d2c__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2d2c__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	42.46 Å
Rg (electron density)	41.41 Å
Total Rg	41.74 Å
Atom count	14982
Residues	1828
Excluded volume	274630 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2d2c__assembly_1__model_1`	hexadecameric （16）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (15)

Entity 1 Entity 1 polymer

Description description	Cytochrome b6
Molecular weight formula_weight	24245.5 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,N
Atom count atom_count	14984

MANVYDWFQERLEIQALADDVTSKYVPPHVNIFYCLGGITLTCFLIQFATGFAMTFYYKPTVTEAYASVQYIMNEVSFGWLIRSIHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWISGVILAVITVSFGVTGYSLPWDQVGYWAVKIVSGVPEAIPVVGVLISDLLRGGSSVGQATLTRYYSAHTFVLPWLIAVFMLLHFLMIRKQGISGPL

Entity 2 Entity 2 polymer

Description description	Cytochrome b6-f complex subunit 4
Molecular weight formula_weight	17636.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,O

MATLKKPDLSDPKLRAKLAKGMGHNYYGEPAWPNDLLYVFPVVIMGTFACIVALSVLDPAMVGEPANPFATPLEILPEWYLYPVFQILRSLPNKLLGVLLMASVPLGLILVPFIENVNKFQNPFRRPVATTIFLFGTLVTIWLGIGAALPLDKTLTLGLF

Entity 3 Entity 3 polymer

Description description	Apocytochrome f
Molecular weight formula_weight	31655.1 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,P

YPFWAQQTYPPTPREPTGRIVCANCHLAAKPAEVEVPQSVLPDTVFKAVVKIPYDTKLQQVAADGSKVGLNVGAVLMLPEGFKIAPEERIPEELKKEVGDVYFQPYKEGQDNVLLVGPLPGEQYQEIVFPVLSPNPTTDKNIHFGKYAIHLGANRGRGQIYPTGEKSNNNVFTASATGTITKIAKEEDEYGNVKYQVSIQTDSGKTVVDTIPAGPELIVSEGQAVKAGEALTNNPNVGGFGQDDTEIVLQDPNRVKWMIAFICLVMLAQLMLILKKKQVEKVQAAEMNF

Entity 4 Entity 4 polymer

Description description	Cytochrome b6-f complex iron-sulfur subunit
Molecular weight formula_weight	19450.2 kDa
EC 编号 ec_number	1.10.99.1
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D,Q

MAQFTESMDVPDMGRRQFMNLLAFGTVTGVALGALYPLVKYFIPPSGGAVGGGTTAKDKLGNNVKVSKFLESHNAGDRVLVQGLKGDPTYIVVESKEAIRDYGINAVCTHLGCVVPWNAAENKFKCPCHGSQYDETGRVIRGPAPLSLALCHATVQDDNIVLTPWTETDFRTGEKPWWV

Entity 5 Entity 5 polymer

Description description	Cytochrome b6-f complex subunit VI
Molecular weight formula_weight	3504.4 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E,R

MILGAVFYIVFIALFFGIAVGIIFAIKSIKLI

Entity 6 Entity 6 polymer

Description description	Cytochrome b6-f complex subunit VII
Molecular weight formula_weight	3843.6 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F,S

MTEEMLYAALLSFGLIFVGWGLGVLLLKIQGAEKE

Entity 7 Entity 7 polymer

Description description	Cytochrome b6-f complex subunit V
Molecular weight formula_weight	4016.7 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G,T

MVEPLLDGLVLGLVFATLGGLFYAAYQQYKRPNELGG

Entity 8 Entity 8 polymer

Description description	Cytochrome b6-f complex subunit VIII
Molecular weight formula_weight	3276.9 kDa
Source method src_method	nat
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H,U

MEIDVLGWVALLVVFTWSIAMVVWGRNGL

Entity 9 Entity 9 non-polymer

Description description	HEME C
Molecular weight formula_weight	618.5 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 10 Entity 10 non-polymer

Description description	(7R,17E)-4-HYDROXY-N,N,N,7-TETRAMETHYL-7-[(8E)-OCTADEC-8-ENOYLOXY]-10-OXO-3,5,9-TRIOXA-4-PHOSPHAHEPTACOS-17-EN-1-AMINIUM 4-OXIDE
Molecular weight formula_weight	801.1 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 11 Entity 11 non-polymer

Description description	2,5-DIBROMO-3-ISOPROPYL-6-METHYLBENZO-1,4-QUINONE
Molecular weight formula_weight	322.0 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 12 Entity 12 non-polymer

Description description	CHLOROPHYLL A
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 13 Entity 13 non-polymer

Description description	FE2/S2 (INORGANIC) CLUSTER
Molecular weight formula_weight	175.8 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 14 Entity 14 non-polymer

Description description	BETA-CAROTENE
Molecular weight formula_weight	536.9 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 15 Entity 15 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	2

▼

6. Fold Classification (SCOP + CATH) 32 domains

SCOP 2.08 (16 domains)

Domain ID domain_id	d2d2ca1
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.21 — Heme-binding four-helical bundle
Superfamily Superfamily superfamily	f.21.1 — Transmembrane di-heme cytochromes
Family Family family	f.21.1.2 — Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)

Domain ID domain_id	d2d2cb1
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.32 — a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Superfamily Superfamily superfamily	f.32.1 — a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Family Family family	f.32.1.1 — a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)

Domain ID domain_id	d2d2cd1
Class class	b — All beta proteins
Fold Fold fold	b.33 — ISP domain
Superfamily Superfamily superfamily	b.33.1 — ISP domain
Family Family family	b.33.1.1 — Rieske iron-sulfur protein (ISP)

Domain ID domain_id	d2d2cd2
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.12 — ISP transmembrane anchor
Family Family family	f.23.12.1 — ISP transmembrane anchor

Domain ID domain_id	d2d2ce1
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.24 — PetL subunit of the cytochrome b6f complex
Family Family family	f.23.24.1 — PetL subunit of the cytochrome b6f complex

Domain ID domain_id	d2d2cf1
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.25 — PetM subunit of the cytochrome b6f complex
Family Family family	f.23.25.1 — PetM subunit of the cytochrome b6f complex

Domain ID domain_id	d2d2cg1
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.26 — PetG subunit of the cytochrome b6f complex
Family Family family	f.23.26.1 — PetG subunit of the cytochrome b6f complex

Domain ID domain_id	d2d2ch1
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.27 — PetN subunit of the cytochrome b6f complex
Family Family family	f.23.27.1 — PetN subunit of the cytochrome b6f complex

Domain ID domain_id	d2d2cn1
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.21 — Heme-binding four-helical bundle
Superfamily Superfamily superfamily	f.21.1 — Transmembrane di-heme cytochromes
Family Family family	f.21.1.2 — Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)

Domain ID domain_id	d2d2co1
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.32 — a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Superfamily Superfamily superfamily	f.32.1 — a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Family Family family	f.32.1.1 — a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)

Domain ID domain_id	d2d2cq1
Class class	b — All beta proteins
Fold Fold fold	b.33 — ISP domain
Superfamily Superfamily superfamily	b.33.1 — ISP domain
Family Family family	b.33.1.1 — Rieske iron-sulfur protein (ISP)

Domain ID domain_id	d2d2cq2
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.12 — ISP transmembrane anchor
Family Family family	f.23.12.1 — ISP transmembrane anchor

Domain ID domain_id	d2d2cr1
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.24 — PetL subunit of the cytochrome b6f complex
Family Family family	f.23.24.1 — PetL subunit of the cytochrome b6f complex

Domain ID domain_id	d2d2cs1
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.25 — PetM subunit of the cytochrome b6f complex
Family Family family	f.23.25.1 — PetM subunit of the cytochrome b6f complex

Domain ID domain_id	d2d2ct1
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.26 — PetG subunit of the cytochrome b6f complex
Family Family family	f.23.26.1 — PetG subunit of the cytochrome b6f complex

Domain ID domain_id	d2d2cu1
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.27 — PetN subunit of the cytochrome b6f complex
Family Family family	f.23.27.1 — PetN subunit of the cytochrome b6f complex

CATH v4.4 (16 domains)

Domain ID domain_id	2d2cA00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	810 — Cytochrome Bc1 Complex; Chain C
Homologous superfamily homologous superfamily	10 — Cytochrome Bc1 Complex; Chain C

Domain ID domain_id	2d2cB01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	510 — Single helix bin

Domain ID domain_id	2d2cB02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	980 — plastocyanin oxidoreductase

Domain ID domain_id	2d2cC01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	830 — Cytochrome f large domain

Domain ID domain_id	2d2cC02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	50 — OB fold (Dihydrolipoamide Acetyltransferase, E2P)
Homologous superfamily homologous superfamily	100 — RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain

Domain ID domain_id	2d2cC03
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	700 — Single helix bin

Domain ID domain_id	2d2cD01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	700 — Single helix bin

Domain ID domain_id	2d2cD02
Class class	2 — Mainly Beta
Architecture architecture	102 — 3-layer Sandwich
Topology topology	10 — Rieske Iron-sulfur Protein
Homologous superfamily homologous superfamily	10 — Rieske [2Fe-2S] iron-sulphur domain

Domain ID domain_id	2d2cN00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	810 — Cytochrome Bc1 Complex; Chain C
Homologous superfamily homologous superfamily	10 — Cytochrome Bc1 Complex; Chain C

Domain ID domain_id	2d2cO01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	510 — Single helix bin

Domain ID domain_id	2d2cO02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	980 — plastocyanin oxidoreductase

Domain ID domain_id	2d2cP01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	830 — Cytochrome f large domain

Domain ID domain_id	2d2cP02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	50 — OB fold (Dihydrolipoamide Acetyltransferase, E2P)
Homologous superfamily homologous superfamily	100 — RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain

Domain ID domain_id	2d2cP03
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	700 — Single helix bin

Domain ID domain_id	2d2cQ01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	700 — Single helix bin

Domain ID domain_id	2d2cQ02
Class class	2 — Mainly Beta
Architecture architecture	102 — 3-layer Sandwich
Topology topology	10 — Rieske Iron-sulfur Protein
Homologous superfamily homologous superfamily	10 — Rieske [2Fe-2S] iron-sulphur domain

▶

Unit-cell length a length_a	156.587 Å
Unit-cell length b length_b	156.587 Å
Unit-cell length c length_c	361.786 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	12

Space group space_group	P 61
Space-group number int_tables_number	169
Crystal system crystal_system	—

Resolution resolution	3.800 Å
Low-resolution limit resolution_low	24.760 Å
R factor r_factor	0.2760
R_work r_work	0.2760
R_free r_free	0.3780

Crystal Structure Of Cytochrome B6F Complex with DBMIB From M. Laminosus

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cytochrome b6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b6-f complex subunit 4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Apocytochrome f

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b6-f complex iron-sulfur subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b6-f complex subunit VI

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b6-f complex subunit VII

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b6-f complex subunit V

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b6-f complex subunit VIII

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2d2c__assembly_1__model_1

2d2c__assembly_1__model_1 | I(q)

2d2c__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (15)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer