4h13

Crystal Structure of the Cytochrome b6f Complex from Mastigocladus laminosus with TDS

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cytochrome b6

OrganismNot specified

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Cytochrome b6-f complex subunit 4 × 2 （P83792） Apocytochrome f × 2 （P83793） Cytochrome b6-f complex iron-sulfur subunit × 2 （P83794） Cytochrome b6-f complex subunit 6 × 2 （P83795） Cytochrome b6-f complex subunit 7 × 2 （P83796） Cytochrome b6-f complex subunit 5 × 2 （P83797） Cytochrome b6-f complex subunit 8 × 2 （P83798） CADMIUM ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 8 (7R,17E)-4-HYDROXY-N,N,N,7-TETRAMETHYL-7-[(8E)-OCTADEC-8-ENOYLOXY]-10-OXO-3,5,9-TRIOXA-4-PHOSPHAHEPTACOS-17-EN-1-AMINIUM 4-OXIDE × 4 PENTADECANE × 2 Octadecane × 2 UNDECYL-MALTOSIDE × 4 8-HYDROXY-5,7-DIMETHOXY-3-METHYL-2-TRIDECYL-4H-CHROMEN-4-ONE × 4 CHLOROPHYLL A × 2 (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2 FE2/S2 (INORGANIC) CLUSTER × 2 N-OCTANE × 2 BETA-CAROTENE × 2 water × 10	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CYB6_MASLA
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–215； UniProt 1–215

Cytochrome b6-f complex subunit 4

OrganismNot specified

UniProt P83792

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Cytochrome b6 × 2 （P83791） Apocytochrome f × 2 （P83793） Cytochrome b6-f complex iron-sulfur subunit × 2 （P83794） Cytochrome b6-f complex subunit 6 × 2 （P83795） Cytochrome b6-f complex subunit 7 × 2 （P83796） Cytochrome b6-f complex subunit 5 × 2 （P83797） Cytochrome b6-f complex subunit 8 × 2 （P83798） CADMIUM ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 8 (7R,17E)-4-HYDROXY-N,N,N,7-TETRAMETHYL-7-[(8E)-OCTADEC-8-ENOYLOXY]-10-OXO-3,5,9-TRIOXA-4-PHOSPHAHEPTACOS-17-EN-1-AMINIUM 4-OXIDE × 4 PENTADECANE × 2 Octadecane × 2 UNDECYL-MALTOSIDE × 4 8-HYDROXY-5,7-DIMETHOXY-3-METHYL-2-TRIDECYL-4H-CHROMEN-4-ONE × 4 CHLOROPHYLL A × 2 (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2 FE2/S2 (INORGANIC) CLUSTER × 2 N-OCTANE × 2 BETA-CAROTENE × 2 water × 10	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PETD_MASLA
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 1–160； UniProt 1–160

Apocytochrome f

OrganismNot specified

UniProt P83793

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Cytochrome b6 × 2 （P83791） Cytochrome b6-f complex subunit 4 × 2 （P83792） Cytochrome b6-f complex iron-sulfur subunit × 2 （P83794） Cytochrome b6-f complex subunit 6 × 2 （P83795） Cytochrome b6-f complex subunit 7 × 2 （P83796） Cytochrome b6-f complex subunit 5 × 2 （P83797） Cytochrome b6-f complex subunit 8 × 2 （P83798） CADMIUM ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 8 (7R,17E)-4-HYDROXY-N,N,N,7-TETRAMETHYL-7-[(8E)-OCTADEC-8-ENOYLOXY]-10-OXO-3,5,9-TRIOXA-4-PHOSPHAHEPTACOS-17-EN-1-AMINIUM 4-OXIDE × 4 PENTADECANE × 2 Octadecane × 2 UNDECYL-MALTOSIDE × 4 8-HYDROXY-5,7-DIMETHOXY-3-METHYL-2-TRIDECYL-4H-CHROMEN-4-ONE × 4 CHLOROPHYLL A × 2 (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2 FE2/S2 (INORGANIC) CLUSTER × 2 N-OCTANE × 2 BETA-CAROTENE × 2 water × 10	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	CYF_MASLA
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 1–289； UniProt 45–333

Cytochrome b6-f complex iron-sulfur subunit

OrganismNot specified

UniProt P83794

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Cytochrome b6 × 2 （P83791） Cytochrome b6-f complex subunit 4 × 2 （P83792） Apocytochrome f × 2 （P83793） Cytochrome b6-f complex subunit 6 × 2 （P83795） Cytochrome b6-f complex subunit 7 × 2 （P83796） Cytochrome b6-f complex subunit 5 × 2 （P83797） Cytochrome b6-f complex subunit 8 × 2 （P83798） CADMIUM ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 8 (7R,17E)-4-HYDROXY-N,N,N,7-TETRAMETHYL-7-[(8E)-OCTADEC-8-ENOYLOXY]-10-OXO-3,5,9-TRIOXA-4-PHOSPHAHEPTACOS-17-EN-1-AMINIUM 4-OXIDE × 4 PENTADECANE × 2 Octadecane × 2 UNDECYL-MALTOSIDE × 4 8-HYDROXY-5,7-DIMETHOXY-3-METHYL-2-TRIDECYL-4H-CHROMEN-4-ONE × 4 CHLOROPHYLL A × 2 (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2 FE2/S2 (INORGANIC) CLUSTER × 2 N-OCTANE × 2 BETA-CAROTENE × 2 water × 10	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	UCRI_MASLA
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain D； PDBConstruct 1–179； UniProt 1–179

Cytochrome b6-f complex subunit 6

OrganismNot specified

UniProt P83795

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Cytochrome b6 × 2 （P83791） Cytochrome b6-f complex subunit 4 × 2 （P83792） Apocytochrome f × 2 （P83793） Cytochrome b6-f complex iron-sulfur subunit × 2 （P83794） Cytochrome b6-f complex subunit 7 × 2 （P83796） Cytochrome b6-f complex subunit 5 × 2 （P83797） Cytochrome b6-f complex subunit 8 × 2 （P83798） CADMIUM ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 8 (7R,17E)-4-HYDROXY-N,N,N,7-TETRAMETHYL-7-[(8E)-OCTADEC-8-ENOYLOXY]-10-OXO-3,5,9-TRIOXA-4-PHOSPHAHEPTACOS-17-EN-1-AMINIUM 4-OXIDE × 4 PENTADECANE × 2 Octadecane × 2 UNDECYL-MALTOSIDE × 4 8-HYDROXY-5,7-DIMETHOXY-3-METHYL-2-TRIDECYL-4H-CHROMEN-4-ONE × 4 CHLOROPHYLL A × 2 (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2 FE2/S2 (INORGANIC) CLUSTER × 2 N-OCTANE × 2 BETA-CAROTENE × 2 water × 10	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PETL_MASLA
Isoform	—
PDB entities	5
Chains and sequence ranges	Author chain E； PDBConstruct 1–32； UniProt 1–32

Cytochrome b6-f complex subunit 7

OrganismNot specified

UniProt P83796

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Cytochrome b6 × 2 （P83791） Cytochrome b6-f complex subunit 4 × 2 （P83792） Apocytochrome f × 2 （P83793） Cytochrome b6-f complex iron-sulfur subunit × 2 （P83794） Cytochrome b6-f complex subunit 6 × 2 （P83795） Cytochrome b6-f complex subunit 5 × 2 （P83797） Cytochrome b6-f complex subunit 8 × 2 （P83798） CADMIUM ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 8 (7R,17E)-4-HYDROXY-N,N,N,7-TETRAMETHYL-7-[(8E)-OCTADEC-8-ENOYLOXY]-10-OXO-3,5,9-TRIOXA-4-PHOSPHAHEPTACOS-17-EN-1-AMINIUM 4-OXIDE × 4 PENTADECANE × 2 Octadecane × 2 UNDECYL-MALTOSIDE × 4 8-HYDROXY-5,7-DIMETHOXY-3-METHYL-2-TRIDECYL-4H-CHROMEN-4-ONE × 4 CHLOROPHYLL A × 2 (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2 FE2/S2 (INORGANIC) CLUSTER × 2 N-OCTANE × 2 BETA-CAROTENE × 2 water × 10	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PETM_MASLA
Isoform	—
PDB entities	6
Chains and sequence ranges	Author chain F； PDBConstruct 1–35； UniProt 1–35

Cytochrome b6-f complex subunit 5

OrganismNot specified

UniProt P83797

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Cytochrome b6 × 2 （P83791） Cytochrome b6-f complex subunit 4 × 2 （P83792） Apocytochrome f × 2 （P83793） Cytochrome b6-f complex iron-sulfur subunit × 2 （P83794） Cytochrome b6-f complex subunit 6 × 2 （P83795） Cytochrome b6-f complex subunit 7 × 2 （P83796） Cytochrome b6-f complex subunit 8 × 2 （P83798） CADMIUM ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 8 (7R,17E)-4-HYDROXY-N,N,N,7-TETRAMETHYL-7-[(8E)-OCTADEC-8-ENOYLOXY]-10-OXO-3,5,9-TRIOXA-4-PHOSPHAHEPTACOS-17-EN-1-AMINIUM 4-OXIDE × 4 PENTADECANE × 2 Octadecane × 2 UNDECYL-MALTOSIDE × 4 8-HYDROXY-5,7-DIMETHOXY-3-METHYL-2-TRIDECYL-4H-CHROMEN-4-ONE × 4 CHLOROPHYLL A × 2 (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2 FE2/S2 (INORGANIC) CLUSTER × 2 N-OCTANE × 2 BETA-CAROTENE × 2 water × 10	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PETG_MASLA
Isoform	—
PDB entities	7
Chains and sequence ranges	Author chain G； PDBConstruct 1–37； UniProt 1–37

Cytochrome b6-f complex subunit 8

OrganismNot specified

UniProt P83798

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 16	Cytochrome b6 × 2 （P83791） Cytochrome b6-f complex subunit 4 × 2 （P83792） Apocytochrome f × 2 （P83793） Cytochrome b6-f complex iron-sulfur subunit × 2 （P83794） Cytochrome b6-f complex subunit 6 × 2 （P83795） Cytochrome b6-f complex subunit 7 × 2 （P83796） Cytochrome b6-f complex subunit 5 × 2 （P83797） CADMIUM ION × 2 PROTOPORPHYRIN IX CONTAINING FE × 8 (7R,17E)-4-HYDROXY-N,N,N,7-TETRAMETHYL-7-[(8E)-OCTADEC-8-ENOYLOXY]-10-OXO-3,5,9-TRIOXA-4-PHOSPHAHEPTACOS-17-EN-1-AMINIUM 4-OXIDE × 4 PENTADECANE × 2 Octadecane × 2 UNDECYL-MALTOSIDE × 4 8-HYDROXY-5,7-DIMETHOXY-3-METHYL-2-TRIDECYL-4H-CHROMEN-4-ONE × 4 CHLOROPHYLL A × 2 (1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate × 2 1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL × 2 FE2/S2 (INORGANIC) CLUSTER × 2 N-OCTANE × 2 BETA-CAROTENE × 2 water × 10	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	PETN_MASLA
Isoform	—
PDB entities	8
Chains and sequence ranges	Author chain H； PDBConstruct 1–29； UniProt 1–29

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4h13
Deposition date deposition_date	2012-09-10
Structure title title	Crystal Structure of the Cytochrome b6f Complex from Mastigocladus laminosus with TDS
Keywords keywords	Alpha helix, beta sheet, Plastoquinol-plastocyanin oxidoreductase, Plastocyanin, Thylakoid membrane, PHOTOSYNTHESIS; PHOTOSYNTHESIS
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4h13__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4h13__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4h13__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	42.93 Å
Rg (electron density)	41.62 Å
Total Rg	41.95 Å
Atom count	33004
Residues	1920
Excluded volume	299190 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4h13__assembly_1__model_1`	hexadecameric （16）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (22)

Entity 1 Entity 1 polymer

Description description	Cytochrome b6
Molecular weight formula_weight	24245.5 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	16526

MANVYDWFQERLEIQALADDVTSKYVPPHVNIFYCLGGITLTCFLIQFATGFAMTFYYKPTVTEAYASVQYIMNEVSFGWLIRSIHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWISGVILAVITVSFGVTGYSLPWDQVGYWAVKIVSGVPEAIPVVGVLISDLLRGGSSVGQATLTRYYSAHTFVLPWLIAVFMLLHFLMIRKQGISGPL

Entity 2 Entity 2 polymer

Description description	Cytochrome b6-f complex subunit 4
Molecular weight formula_weight	17687.0 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

MATLKKPDLSDPKLRAKLAKGMGHNYYGEPAWPNDLLYVFPVVIMGTFACIVALSVLDPAMVGEPADPFATPLEILPEWYLYPVFQILRSVPNKLLGVLLMASVPLGLILVPFIENVNKFQNPFRRPVATTIFLFGTLVTIWLGIGATFPLDKTLTLGLF

Entity 3 Entity 3 polymer

Description description	Apocytochrome f
Molecular weight formula_weight	31655.1 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C

YPFWAQQTYPPTPREPTGRIVCANCHLAAKPAEVEVPQSVLPDTVFKAVVKIPYDTKLQQVAADGSKVGLNVGAVLMLPEGFKIAPEERIPEELKKEVGDVYFQPYKEGQDNVLLVGPLPGEQYQEIVFPVLSPNPTTDKNIHFGKYAIHLGANRGRGQIYPTGEKSNNNVFTASATGTITKIAKEEDEYGNVKYQVSIQTDSGKTVVDTIPAGPELIVSEGQAVKAGEALTNNPNVGGFGQDDTEIVLQDPNRVKWMIAFICLVMLAQLMLILKKKQVEKVQAAEMNF

Entity 4 Entity 4 polymer

Description description	Cytochrome b6-f complex iron-sulfur subunit
Molecular weight formula_weight	19422.2 kDa
EC 编号 ec_number	1.10.9.1
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	D

MAQFTESMDVPDMGRRQFMNLLAFGTVTGVALGALYPLVKYFIPPSGGAVGGGTTAKDKLGNNVKVSKFLESHNAGDRVLVQGLKGDPTYIVVESKEAIRDYGINAVCTHLGCVVPWNAAENKFKCPCHGSQYDETGKVIRGPAPLSLALCHATVQDDNIVLTPWTETDFRTGEKPWWV

Entity 5 Entity 5 polymer

Description description	Cytochrome b6-f complex subunit 6
Molecular weight formula_weight	3504.4 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	E

MILGAVFYIVFIALFFGIAVGIIFAIKSIKLI

Entity 6 Entity 6 polymer

Description description	Cytochrome b6-f complex subunit 7
Molecular weight formula_weight	3843.6 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	F

MTEEMLYAALLSFGLIFVGWGLGVLLLKIQGAEKE

Entity 7 Entity 7 polymer

Description description	Cytochrome b6-f complex subunit 5
Molecular weight formula_weight	4016.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	G

MVEPLLDGLVLGLVFATLGGLFYAAYQQYKRPNELGG

Entity 8 Entity 8 polymer

Description description	Cytochrome b6-f complex subunit 8
Molecular weight formula_weight	3276.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	H

MEIDVLGWVALLVVFTWSIAMVVWGRNGL

Entity 9 Entity 9 non-polymer

Description description	CADMIUM ION
Molecular weight formula_weight	112.4 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 10 Entity 10 non-polymer

Description description	PROTOPORPHYRIN IX CONTAINING FE
Molecular weight formula_weight	616.5 kDa
Source method src_method	syn
Copy count entity_count	4

Entity 11 Entity 11 non-polymer

Description description	(7R,17E)-4-HYDROXY-N,N,N,7-TETRAMETHYL-7-[(8E)-OCTADEC-8-ENOYLOXY]-10-OXO-3,5,9-TRIOXA-4-PHOSPHAHEPTACOS-17-EN-1-AMINIUM 4-OXIDE
Molecular weight formula_weight	801.1 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 12 Entity 12 non-polymer

Description description	PENTADECANE
Molecular weight formula_weight	212.4 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 13 Entity 13 non-polymer

Description description	Octadecane
Molecular weight formula_weight	254.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 14 Entity 14 non-polymer

Description description	UNDECYL-MALTOSIDE
Molecular weight formula_weight	496.6 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 15 Entity 15 non-polymer

Description description	8-HYDROXY-5,7-DIMETHOXY-3-METHYL-2-TRIDECYL-4H-CHROMEN-4-ONE
Molecular weight formula_weight	418.6 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 16 Entity 16 non-polymer

Description description	CHLOROPHYLL A
Molecular weight formula_weight	893.5 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 17 Entity 17 non-polymer

Description description	(1R)-2-(dodecanoyloxy)-1-[(phosphonooxy)methyl]ethyl tetradecanoate
Molecular weight formula_weight	564.7 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 18 Entity 18 non-polymer

Description description	1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL
Molecular weight formula_weight	795.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 19 Entity 19 non-polymer

Description description	FE2/S2 (INORGANIC) CLUSTER
Molecular weight formula_weight	175.8 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 20 Entity 20 non-polymer

Description description	N-OCTANE
Molecular weight formula_weight	114.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 21 Entity 21 non-polymer

Description description	BETA-CAROTENE
Molecular weight formula_weight	536.9 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 22 Entity 22 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	24

▼

6. Fold Classification (SCOP + CATH) 15 domains

SCOP 2.08 (7 domains)

Domain ID domain_id	d4h13a_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.21 — Heme-binding four-helical bundle
Superfamily Superfamily superfamily	f.21.1 — Transmembrane di-heme cytochromes
Family Family family	f.21.1.2 — Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)

Domain ID domain_id	d4h13b_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.32 — a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Superfamily Superfamily superfamily	f.32.1 — a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)
Family Family family	f.32.1.1 — a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase)

Domain ID domain_id	d4h13d1
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.12 — ISP transmembrane anchor
Family Family family	f.23.12.0 — automated matches

Domain ID domain_id	d4h13d2
Class class	b — All beta proteins
Fold Fold fold	b.33 — ISP domain
Superfamily Superfamily superfamily	b.33.1 — ISP domain
Family Family family	b.33.1.1 — Rieske iron-sulfur protein (ISP)

Domain ID domain_id	d4h13f_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.25 — PetM subunit of the cytochrome b6f complex
Family Family family	f.23.25.1 — PetM subunit of the cytochrome b6f complex

Domain ID domain_id	d4h13g_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.26 — PetG subunit of the cytochrome b6f complex
Family Family family	f.23.26.1 — PetG subunit of the cytochrome b6f complex

Domain ID domain_id	d4h13h_
Class class	f — Membrane and cell surface proteins and peptides
Fold Fold fold	f.23 — Single transmembrane helix
Superfamily Superfamily superfamily	f.23.27 — PetN subunit of the cytochrome b6f complex
Family Family family	f.23.27.1 — PetN subunit of the cytochrome b6f complex

CATH v4.4 (8 domains)

Domain ID domain_id	4h13A00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	810 — Cytochrome Bc1 Complex; Chain C
Homologous superfamily homologous superfamily	10 — Cytochrome Bc1 Complex; Chain C

Domain ID domain_id	4h13B01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	510 — Single helix bin

Domain ID domain_id	4h13B02
Class class	1 — Mainly Alpha
Architecture architecture	10 — Orthogonal Bundle
Topology topology	287 — Helix Hairpins
Homologous superfamily homologous superfamily	980 — plastocyanin oxidoreductase

Domain ID domain_id	4h13C01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	830 — Cytochrome f large domain

Domain ID domain_id	4h13C02
Class class	2 — Mainly Beta
Architecture architecture	40 — Beta Barrel
Topology topology	50 — OB fold (Dihydrolipoamide Acetyltransferase, E2P)
Homologous superfamily homologous superfamily	100 — RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain

Domain ID domain_id	4h13C03
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	700 — Single helix bin

Domain ID domain_id	4h13D01
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	700 — Single helix bin

Domain ID domain_id	4h13D02
Class class	2 — Mainly Beta
Architecture architecture	102 — 3-layer Sandwich
Topology topology	10 — Rieske Iron-sulfur Protein
Homologous superfamily homologous superfamily	10 — Rieske [2Fe-2S] iron-sulphur domain

▶

Unit-cell length a length_a	157.197 Å
Unit-cell length b length_b	157.197 Å
Unit-cell length c length_c	363.276 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	120.00 °
Molecules per unit cell Z z_pdb	12

Space group space_group	P 61 2 2
Space-group number int_tables_number	178
Crystal system crystal_system	—

Resolution resolution	3.070 Å
Low-resolution limit resolution_low	34.567 Å
R factor r_factor	0.2148
R_work r_work	0.2136
R_free r_free	0.2380

Crystal Structure of the Cytochrome b6f Complex from Mastigocladus laminosus with TDS

1. Protein Identity and Related Structures Protein Identity & Related Structures

Cytochrome b6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b6-f complex subunit 4

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Apocytochrome f

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b6-f complex iron-sulfur subunit

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b6-f complex subunit 6

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b6-f complex subunit 7

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b6-f complex subunit 5

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Cytochrome b6-f complex subunit 8

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4h13__assembly_1__model_1

4h13__assembly_1__model_1 | I(q)

4h13__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

5. Entities and Polymers Entities & Polymers (22)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer