2d7c

Crystal structure of human Rab11 in complex with FIP3 Rab-binding domain

Method: X-RAY DIFFRACTION D_max: 85.2 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Ras-related protein Rab-11A

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 6–172	Fragment：residues 7-173 Mutation：Q70L Non-standard monomer：Yes (specific site not provided by mmCIF)	Rab11 family-interacting protein 3 × 1 （O75154） MG MAGNESIUM ION × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6；289 K；20% iso-propanol, 3% (w/v) PEG 4000, 0.05M MES-NaOH, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 289K	Resolution 1.75 Å R-free 0.224
2	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain B； UniProt 6–172	Fragment：residues 7-173 Mutation：Q70L Non-standard monomer：Yes (specific site not provided by mmCIF)	Rab11 family-interacting protein 3 × 1 （O75154） MG MAGNESIUM ION × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6；289 K；20% iso-propanol, 3% (w/v) PEG 4000, 0.05M MES-NaOH, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 289K	Resolution 1.75 Å R-free 0.224

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 2D7C	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1YZK GppNHp bound Rab11 GTPase Deposited 2005-02-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 8–175（168 aa）	Not recorded	MG MAGNESIUM ION × 1 GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6；277 K；NaCl, Glycerol, MES, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 4K	Resolution 2.00 Å R-free 0.228
2GZD Crystal Structure of Rab11 in Complex with Rab11-FIP2 Deposited 2006-05-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–172（172 aa） Fragment：G protein domain Chain B 1–172（172 aa） Fragment：G protein domain	Mutation：Q70L Non-standard monomer：Yes (specific site not provided by mmCIF) Mutation：Q70L Non-standard monomer：Yes (specific site not provided by mmCIF)	MG MAGNESIUM ION × 2 GTP GUANOSINE-5'-TRIPHOSPHATE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 5；298 K；Ammonium phosphate buffer, between 0.1 and 0.5 M concentration, VAPOR DIFFUSION, temperature 298K	Resolution 2.44 Å R-free 0.279
2GZH Crystal Structure of Rab11 in Complex with Rab11-Family Interacting Protein 2 Deposited 2006-05-11	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 1–172（172 aa） Fragment：G protein domain	Mutation：Q70L Non-standard monomer：Yes (specific site not provided by mmCIF)	PO4 PHOSPHATE ION × 2 MG MAGNESIUM ION × 4 GTP GUANOSINE-5'-TRIPHOSPHATE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 5；298 K；Ammonium phosphate buffer, approximately 0.3M concentration, pH 5, VAPOR DIFFUSION, temperature 298K	Resolution 2.47 Å R-free 0.254
2HV8 Crystal structure of GTP-bound Rab11 in complex with FIP3 Deposited 2006-07-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain A 5–174（170 aa） Fragment：GTPase domain	Mutation：Q70L	MG MAGNESIUM ION × 2 SO4 SULFATE ION × 2 GTP GUANOSINE-5'-TRIPHOSPHATE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；20% PEG4000, 0.4M Ammonium Sulfate, 100mM MES, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 1.86 Å R-free 0.237
2HV8 Crystal structure of GTP-bound Rab11 in complex with FIP3 Deposited 2006-07-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 5–174（170 aa） Fragment：GTPase domain Chain C 5–174（170 aa） Fragment：GTPase domain	Mutation：Q70L Mutation：Q70L	MG MAGNESIUM ION × 2 SO4 SULFATE ION × 4 GTP GUANOSINE-5'-TRIPHOSPHATE × 2 2ME METHOXYETHANE × 1 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；20% PEG4000, 0.4M Ammonium Sulfate, 100mM MES, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 1.86 Å R-free 0.237
4C4P Crystal Structure of Wild-Type Rab11 Complexed to FIP2 Deposited 2013-09-07	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–173（173 aa） Fragment：RESIDUES 1-173	Not recorded	GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.00 Å R-free 0.223
4D0L Phosphatidylinositol 4-kinase III beta-PIK93 in a complex with Rab11a- GTP gammaS Deposited 2014-04-29	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–216（216 aa）	Mutation：YES	093 N-(5-(4-CHLORO-3-(2-HYDROXY-ETHYLSULFAMOYL)- PHENYLTHIAZOLE-2-YL)-ACETAMIDE × 1 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.6；15% (W/V) PEG 4000, 0.1 M NA CITRATE PH 5.6, AND 0.2 M AMMONIUM ACETATE	Resolution 2.94 Å R-free 0.259
4D0L Phosphatidylinositol 4-kinase III beta-PIK93 in a complex with Rab11a- GTP gammaS Deposited 2014-04-29	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 1–216（216 aa）	Mutation：YES	093 N-(5-(4-CHLORO-3-(2-HYDROXY-ETHYLSULFAMOYL)- PHENYLTHIAZOLE-2-YL)-ACETAMIDE × 1 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.6；15% (W/V) PEG 4000, 0.1 M NA CITRATE PH 5.6, AND 0.2 M AMMONIUM ACETATE	Resolution 2.94 Å R-free 0.259
4D0L Phosphatidylinositol 4-kinase III beta-PIK93 in a complex with Rab11a- GTP gammaS Deposited 2014-04-29	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 1–216（216 aa）	Mutation：YES	093 N-(5-(4-CHLORO-3-(2-HYDROXY-ETHYLSULFAMOYL)- PHENYLTHIAZOLE-2-YL)-ACETAMIDE × 1 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.6；15% (W/V) PEG 4000, 0.1 M NA CITRATE PH 5.6, AND 0.2 M AMMONIUM ACETATE	Resolution 2.94 Å R-free 0.259
4D0M Phosphatidylinositol 4-kinase III beta in a complex with Rab11a-GTP- gamma-S and the Rab-binding domain of FIP3 Deposited 2014-04-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain B 1–216（216 aa） Chain D 1–216（216 aa） Chain P 1–216（216 aa） Chain T 1–216（216 aa）	Mutation：YES Mutation：YES Mutation：YES Mutation：YES	093 N-(5-(4-CHLORO-3-(2-HYDROXY-ETHYLSULFAMOYL)- PHENYLTHIAZOLE-2-YL)-ACETAMIDE × 4 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 4 MG MAGNESIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions 16% PEG 6K, 0.01 M NA CITRATE	Resolution 6.00 Å R-free 0.359
4D0M Phosphatidylinositol 4-kinase III beta in a complex with Rab11a-GTP- gamma-S and the Rab-binding domain of FIP3 Deposited 2014-04-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain H 1–216（216 aa） Chain J 1–216（216 aa） Chain N 1–216（216 aa） Chain R 1–216（216 aa）	Mutation：YES Mutation：YES Mutation：YES Mutation：YES	093 N-(5-(4-CHLORO-3-(2-HYDROXY-ETHYLSULFAMOYL)- PHENYLTHIAZOLE-2-YL)-ACETAMIDE × 4 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 4 MG MAGNESIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions 16% PEG 6K, 0.01 M NA CITRATE	Resolution 6.00 Å R-free 0.359
4D0M Phosphatidylinositol 4-kinase III beta in a complex with Rab11a-GTP- gamma-S and the Rab-binding domain of FIP3 Deposited 2014-04-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain X 1–216（216 aa） Chain Z 1–216（216 aa） Chain d 1–216（216 aa） Chain h 1–216（216 aa）	Mutation：YES Mutation：YES Mutation：YES Mutation：YES	093 N-(5-(4-CHLORO-3-(2-HYDROXY-ETHYLSULFAMOYL)- PHENYLTHIAZOLE-2-YL)-ACETAMIDE × 4 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 4 MG MAGNESIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions 16% PEG 6K, 0.01 M NA CITRATE	Resolution 6.00 Å R-free 0.359
4LWZ Crystal structure of Myo5b globular tail domain in complex with inactive Rab11a Deposited 2013-07-29	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–177（177 aa） Fragment：Dilute domain residues 1456-1848	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；298 K；17% peg, 100 mM NaCl, pH 8, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.55 Å R-free 0.295
4LWZ Crystal structure of Myo5b globular tail domain in complex with inactive Rab11a Deposited 2013-07-29	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 1–177（177 aa） Fragment：Dilute domain residues 1456-1848	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；298 K；17% peg, 100 mM NaCl, pH 8, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.55 Å R-free 0.295
4LX0 Crystal structure of Myo5b globular tail domain in complex with active Rab11a Deposited 2013-07-29	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–177（177 aa） Fragment：Dilute domain residues 1456-1848	Not recorded	MG MAGNESIUM ION × 1 BEF BERYLLIUM TRIFLUORIDE ION × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1 GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；298 K；10 % peg, 90 mM NaF, pH 8, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.19 Å R-free 0.218
4LX0 Crystal structure of Myo5b globular tail domain in complex with active Rab11a Deposited 2013-07-29	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain C 1–177（177 aa） Fragment：Dilute domain residues 1456-1848	Not recorded	MG MAGNESIUM ION × 1 BEF BERYLLIUM TRIFLUORIDE ION × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；298 K；10 % peg, 90 mM NaF, pH 8, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.19 Å R-free 0.218
4UJ3 Crystal structure of human Rab11-Rabin8-FIP3 Deposited 2015-04-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 4–186（183 aa） Fragment：GTPASE DOMAIN	Mutation：YES	GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.6；50MM MES PH 5.6, 0.2M AMMONIUM SULFATE AND 12% PEG 8000	Resolution 3.00 Å R-free 0.250
4UJ3 Crystal structure of human Rab11-Rabin8-FIP3 Deposited 2015-04-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain D 4–186（183 aa） Fragment：GTPASE DOMAIN	Mutation：YES	GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.6；50MM MES PH 5.6, 0.2M AMMONIUM SULFATE AND 12% PEG 8000	Resolution 3.00 Å R-free 0.250
4UJ3 Crystal structure of human Rab11-Rabin8-FIP3 Deposited 2015-04-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain G 4–186（183 aa） Fragment：GTPASE DOMAIN	Mutation：YES	GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.6；50MM MES PH 5.6, 0.2M AMMONIUM SULFATE AND 12% PEG 8000	Resolution 3.00 Å R-free 0.250
4UJ3 Crystal structure of human Rab11-Rabin8-FIP3 Deposited 2015-04-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain J 4–186（183 aa） Fragment：GTPASE DOMAIN	Mutation：YES	GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.6；50MM MES PH 5.6, 0.2M AMMONIUM SULFATE AND 12% PEG 8000	Resolution 3.00 Å R-free 0.250
4UJ3 Crystal structure of human Rab11-Rabin8-FIP3 Deposited 2015-04-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain M 4–186（183 aa） Fragment：GTPASE DOMAIN	Mutation：YES	GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 MG MAGNESIUM ION × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.6；50MM MES PH 5.6, 0.2M AMMONIUM SULFATE AND 12% PEG 8000	Resolution 3.00 Å R-free 0.250
4UJ3 Crystal structure of human Rab11-Rabin8-FIP3 Deposited 2015-04-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain P 4–186（183 aa） Fragment：GTPASE DOMAIN	Mutation：YES	GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.6；50MM MES PH 5.6, 0.2M AMMONIUM SULFATE AND 12% PEG 8000	Resolution 3.00 Å R-free 0.250
4UJ3 Crystal structure of human Rab11-Rabin8-FIP3 Deposited 2015-04-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 7 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain S 4–186（183 aa） Fragment：GTPASE DOMAIN	Mutation：YES	GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.6；50MM MES PH 5.6, 0.2M AMMONIUM SULFATE AND 12% PEG 8000	Resolution 3.00 Å R-free 0.250
4UJ3 Crystal structure of human Rab11-Rabin8-FIP3 Deposited 2015-04-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 8 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain V 4–186（183 aa） Fragment：GTPASE DOMAIN	Mutation：YES	GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 MG MAGNESIUM ION × 1 PG4 TETRAETHYLENE GLYCOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.6；50MM MES PH 5.6, 0.2M AMMONIUM SULFATE AND 12% PEG 8000	Resolution 3.00 Å R-free 0.250
4UJ4 Crystal structure of human Rab11-Rabin8-FIP3 Deposited 2015-04-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain D 4–186（183 aa） Fragment：GTPASE DOMAIN, RESIDUES 4-186 Chain G 4–186（183 aa） Fragment：GTPASE DOMAIN, RESIDUES 4-186	Mutation：YES Mutation：YES	GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2 MG MAGNESIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.8；50MM MES PH 5.8, 0.2M AMMONIUM SULFATE AND 14% PEG 8000	Resolution 4.20 Å R-free 0.266
4UJ4 Crystal structure of human Rab11-Rabin8-FIP3 Deposited 2015-04-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 4–186（183 aa） Fragment：GTPASE DOMAIN, RESIDUES 4-186 Chain J 4–186（183 aa） Fragment：GTPASE DOMAIN, RESIDUES 4-186	Mutation：YES Mutation：YES	GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2 MG MAGNESIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.8；50MM MES PH 5.8, 0.2M AMMONIUM SULFATE AND 14% PEG 8000	Resolution 4.20 Å R-free 0.266
4UJ4 Crystal structure of human Rab11-Rabin8-FIP3 Deposited 2015-04-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain A 4–186（183 aa） Fragment：GTPASE DOMAIN, RESIDUES 4-186 Chain J 4–186（183 aa） Fragment：GTPASE DOMAIN, RESIDUES 4-186	Mutation：YES Mutation：YES	GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2 MG MAGNESIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.8；50MM MES PH 5.8, 0.2M AMMONIUM SULFATE AND 14% PEG 8000	Resolution 4.20 Å R-free 0.266
4UJ5 Crystal structure of human Rab11-Rabin8-FIP3 Deposited 2015-04-08	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 6–186（181 aa） Fragment：GTPASE DOMAIN, RESIDUES 6-186	Mutation：YES	GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 MG MAGNESIUM ION × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7；0.1M HEPES PH 7.0, 0.2M LITHIUM SULFATE AND 24% PEG 3350	Resolution 2.60 Å R-free 0.272
4UJ5 Crystal structure of human Rab11-Rabin8-FIP3 Deposited 2015-04-08	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 6–186（181 aa） Fragment：GTPASE DOMAIN, RESIDUES 6-186	Mutation：YES	GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7；0.1M HEPES PH 7.0, 0.2M LITHIUM SULFATE AND 24% PEG 3350	Resolution 2.60 Å R-free 0.272
5C46 Crystal structure of an engineered construct of phosphatidylinositol 4 kinase III beta in complex with GTP gamma S loaded Rab11 Deposited 2015-06-17	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 1–216（216 aa）	Mutation：Q70L	SO4 SULFATE ION × 2 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.6；290 K；PEG-4000, sodium citrate, ammonium sulfate, glycerol	Resolution 2.65 Å R-free 0.246
5C4G Crystal structure of an engineered construct of phosphatidylinositol 4 kinase III beta with the inhibitor BQR695 in complex with GDP loaded Rab11 Deposited 2015-06-18	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–216（216 aa）	Mutation：Q70L	MG MAGNESIUM ION × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1 SO4 SULFATE ION × 2 BQR N~2~-[7-(3,4-dimethoxyphenyl)quinoxalin-2-yl]-N-methylglycinamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.6；290 K；PEG-4000, sodium citrate, ammonium sulfate, glycerol	Resolution 3.20 Å R-free 0.287
5EUQ Crystal structure of an engineered construct of phosphatidylinositol 4 kinase III beta with a potent and selective inhibitor in complex with GDP loaded Rab11 Deposited 2015-11-19	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–216（216 aa）	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1 SO4 SULFATE ION × 2 5S8 ~{N}-[5-[3-[[(4-hydroxyphenyl)amino]-bis(oxidanyl)-$l^{4}-sulfanyl]-4-methoxy-phenyl]-4-methyl-1,3-thiazol-2-yl]cyclopentanecarboxamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 5.6；290 K；PEG-4000, sodium citrate, ammonium sulfate, glycerol	Resolution 3.20 Å R-free 0.266
5EZ5 Crystal structure of active Rab11A (S20V) in complex with GTP Deposited 2015-11-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 8–175（168 aa） Fragment：UNP residues 8-175 Chain B 8–175（168 aa） Fragment：UNP residues 8-175	Mutation：S20V Mutation：S20V	MG MAGNESIUM ION × 2 GTP GUANOSINE-5'-TRIPHOSPHATE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；Sodium chloride, Tris, Magnessium chloride	Resolution 2.40 Å R-free 0.304
5EZ5 Crystal structure of active Rab11A (S20V) in complex with GTP Deposited 2015-11-26	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 8–175（168 aa） Fragment：UNP residues 8-175 Chain B 8–175（168 aa） Fragment：UNP residues 8-175	Mutation：S20V Mutation：S20V	MG MAGNESIUM ION × 2 GTP GUANOSINE-5'-TRIPHOSPHATE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；Sodium chloride, Tris, Magnessium chloride	Resolution 2.40 Å R-free 0.304
5FBL PI4KB in complex with Rab11 and the MI356 Inhibitor Deposited 2015-12-14	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–216（216 aa）	Not recorded	5W9 ~{N}-[2-[[6-chloranyl-3-(4-methoxy-3-morpholin-4-ylsulfonyl-phenyl)-2-methyl-imidazo[1,2-b]pyridazin-8-yl]amino]ethyl]ethanamide × 1 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；291 K；1M Lithium chloride, 0.1M Citric acid pH=5, 10% (w/v) PEG 6000	Resolution 3.37 Å R-free 0.269
5FBQ PI4KB in complex with Rab11 and the MI358 Inhibitor Deposited 2015-12-14	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–216（216 aa）	Not recorded	5W6 ~{N}-[2-[[6-chloranyl-3-[3-[4-(hydroxymethyl)piperidin-1-yl]sulfonyl-4-methoxy-phenyl]-2-methyl-imidazo[1,2-b]pyridazin-8-yl]amino]ethyl]ethanamide × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；291 K；0.2M magnesium chloride, 0.1M Tris PH=7, 10% (w/v) PEG 8000	Resolution 3.79 Å R-free 0.302
5FBR PI4KB in complex with Rab11 and the MI359 Inhibitor Deposited 2015-12-14	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–216（216 aa）	Not recorded	5W7 ~{N}-[2-[[3-[3-[(4-azanylcyclohexyl)sulfamoyl]-4-methoxy-phenyl]-6-chloranyl-2-methyl-imidazo[1,2-b]pyridazin-8-yl]amino]ethyl]ethanamide × 1 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；291 K；0.15M amonium sulfate, 0.1M MES pH=6, 15% PEG 4000	Resolution 3.28 Å R-free 0.264
5FBV PI4KB in complex with Rab11 and the MI364 Inhibitor Deposited 2015-12-14	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–216（216 aa）	Not recorded	5W3 ~{N}-[2-[[6-chloranyl-3-[3-(2-hydroxyethylsulfamoyl)-4-methoxy-phenyl]-2-methyl-imidazo[1,2-b]pyridazin-8-yl]amino]ethy l]ethanamide × 1 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；291 K；0.15M amonium sulfate, 0.1M MEW pH=6, 15% PEG 4000	Resolution 3.29 Å R-free 0.281
5FBW PI4KB in complex with Rab11 and the MI369 Inhibitor Deposited 2015-12-14	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–216（216 aa）	Not recorded	5W8 ~{N}-[2-[[6-chloranyl-3-[4-methoxy-3-[[(2~{R})-1-oxidanylbutan-2-yl]sulfamoyl]phenyl]-2-methyl-imidazo[1,2-b]pyridazin-8-yl]amino]ethyl]ethanamide × 1 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；291 K；0.2M ammonium sulfate, 0.1M MES pH=6.5, 20% (w/v) PEG 8000	Resolution 3.49 Å R-free 0.283
5JCZ Rab11 bound to MyoVa-GTD Deposited 2016-04-15	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–177（177 aa）	Not recorded	MG MAGNESIUM ION × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1 BEF BERYLLIUM TRIFLUORIDE ION × 1 EDO 1,2-ETHANEDIOL × 5 ACT ACETATE ION × 1 GOL GLYCEROL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；290 K；7% (w/v) PEG-8000, 50 mM Bicine, 50 mM Tris, 30mM sodium fluoride, 20% (v/v) ethylene glycol	Resolution 2.06 Å R-free 0.208
5JCZ Rab11 bound to MyoVa-GTD Deposited 2016-04-15	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain D 1–177（177 aa）	Not recorded	MG MAGNESIUM ION × 2 GDP GUANOSINE-5'-DIPHOSPHATE × 1 BEF BERYLLIUM TRIFLUORIDE ION × 1 EDO 1,2-ETHANEDIOL × 6 ACT ACETATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；290 K；7% (w/v) PEG-8000, 50 mM Bicine, 50 mM Tris, 30mM sodium fluoride, 20% (v/v) ethylene glycol	Resolution 2.06 Å R-free 0.208
5JCZ Rab11 bound to MyoVa-GTD Deposited 2016-04-15	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain I 1–177（177 aa）	Not recorded	MG MAGNESIUM ION × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1 BEF BERYLLIUM TRIFLUORIDE ION × 1 EDO 1,2-ETHANEDIOL × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；290 K；7% (w/v) PEG-8000, 50 mM Bicine, 50 mM Tris, 30mM sodium fluoride, 20% (v/v) ethylene glycol	Resolution 2.06 Å R-free 0.208
6DJL Crystal structure of the Rab11 GEF SH3BP5 bound to nucleotide free Rab11A Deposited 2018-05-25	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 1–216（216 aa）	Mutation：Q70L	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；289 K；23% PEG-3350, 200 mM NaCl, 100 mM Bis Tris pH-6.5	Resolution 3.10 Å R-free 0.278
6DJL Crystal structure of the Rab11 GEF SH3BP5 bound to nucleotide free Rab11A Deposited 2018-05-25	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 1–216（216 aa）	Mutation：Q70L	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；289 K；23% PEG-3350, 200 mM NaCl, 100 mM Bis Tris pH-6.5	Resolution 3.10 Å R-free 0.278
6DJL Crystal structure of the Rab11 GEF SH3BP5 bound to nucleotide free Rab11A Deposited 2018-05-25	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 1–216（216 aa）	Mutation：Q70L	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；289 K；23% PEG-3350, 200 mM NaCl, 100 mM Bis Tris pH-6.5	Resolution 3.10 Å R-free 0.278
6DJL Crystal structure of the Rab11 GEF SH3BP5 bound to nucleotide free Rab11A Deposited 2018-05-25	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 1–216（216 aa）	Mutation：Q70L	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；289 K；23% PEG-3350, 200 mM NaCl, 100 mM Bis Tris pH-6.5	Resolution 3.10 Å R-free 0.278
6IXV Crystal structure of SH3BP5-Rab11a Deposited 2018-12-12	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain E 1–173（173 aa）	Not recorded	PO4 PHOSPHATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.6M NaCl, 0.1M NaH2PO4 pH 6.8, 16% PEG 2000	Resolution 3.80 Å R-free 0.259
6IXV Crystal structure of SH3BP5-Rab11a Deposited 2018-12-12	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain F 1–173（173 aa）	Not recorded	PO4 PHOSPHATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.6M NaCl, 0.1M NaH2PO4 pH 6.8, 16% PEG 2000	Resolution 3.80 Å R-free 0.259
6IXV Crystal structure of SH3BP5-Rab11a Deposited 2018-12-12	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain G 1–173（173 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.6M NaCl, 0.1M NaH2PO4 pH 6.8, 16% PEG 2000	Resolution 3.80 Å R-free 0.259
6IXV Crystal structure of SH3BP5-Rab11a Deposited 2018-12-12	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain H 1–173（173 aa）	Not recorded	PO4 PHOSPHATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.6M NaCl, 0.1M NaH2PO4 pH 6.8, 16% PEG 2000	Resolution 3.80 Å R-free 0.259
6IY1 Structure of human Ras-related protein Rab11 Deposited 2018-12-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 9–173（165 aa）	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.15M Li2SO4, 0.1M Glycine, 0.8M NaH2PO4 1.2M Na2HPO4	Resolution 2.11 Å R-free 0.261
6IY1 Structure of human Ras-related protein Rab11 Deposited 2018-12-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 9–173（165 aa）	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.15M Li2SO4, 0.1M Glycine, 0.8M NaH2PO4 1.2M Na2HPO4	Resolution 2.11 Å R-free 0.261
6IY1 Structure of human Ras-related protein Rab11 Deposited 2018-12-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 9–173（165 aa）	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.15M Li2SO4, 0.1M Glycine, 0.8M NaH2PO4 1.2M Na2HPO4	Resolution 2.11 Å R-free 0.261
6IY1 Structure of human Ras-related protein Rab11 Deposited 2018-12-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 7–173（167 aa）	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.15M Li2SO4, 0.1M Glycine, 0.8M NaH2PO4 1.2M Na2HPO4	Resolution 2.11 Å R-free 0.261
6IY1 Structure of human Ras-related protein Rab11 Deposited 2018-12-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain E 9–173（165 aa）	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.15M Li2SO4, 0.1M Glycine, 0.8M NaH2PO4 1.2M Na2HPO4	Resolution 2.11 Å R-free 0.261
6IY1 Structure of human Ras-related protein Rab11 Deposited 2018-12-12	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain F 6–173（168 aa）	Not recorded	GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；293 K；0.15M Li2SO4, 0.1M Glycine, 0.8M NaH2PO4 1.2M Na2HPO4	Resolution 2.11 Å R-free 0.261
8VOF GI targeted CpPI4K inhibitor Deposited 2024-01-15	Different construct Different mutation/modification Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain B 1–216（216 aa）	Mutation：Q70L	A1ADE methyl 2-chloro-5-(methyl{(8R)-3-[4-(methylcarbamoyl)phenyl]pyrazolo[1,5-a]pyridine-5-carbonyl}amino)benzoate × 1 SO4 SULFATE ION × 1 GDP GUANOSINE-5'-DIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8；294 K；0.5M ammonium sulfate, 0.088M sodium citrate, 0.875M lithium sulfate, 2.4% glycerol, 2.5% ethylene glycol, 50mM HEPES pH 6.8	Resolution 3.00 Å R-free 0.270

26 other PDB entries and 57 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RB11A_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–167； UniProt 6–172 Author chain B； PDBConstruct 1–167； UniProt 6–172

Rab11 family-interacting protein 3

Homo sapiens

UniProt O75154

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain C； UniProt 715–756	Fragment：Rab-binding domain Non-standard monomer：Yes (specific site not provided by mmCIF)	Ras-related protein Rab-11A × 1 （P62491） MG MAGNESIUM ION × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6；289 K；20% iso-propanol, 3% (w/v) PEG 4000, 0.05M MES-NaOH, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 289K	Resolution 1.75 Å R-free 0.224
2	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain D； UniProt 715–756	Fragment：Rab-binding domain Non-standard monomer：Yes (specific site not provided by mmCIF)	Ras-related protein Rab-11A × 1 （P62491） MG MAGNESIUM ION × 1 GTP GUANOSINE-5'-TRIPHOSPHATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions：VAPOR DIFFUSION, HANGING DROP；pH 6；289 K；20% iso-propanol, 3% (w/v) PEG 4000, 0.05M MES-NaOH, pH 6.0, VAPOR DIFFUSION, HANGING DROP, temperature 289K	Resolution 1.75 Å R-free 0.224

Other States of the Same Protein in the Database

Other PDB	Difference from Current Entry 2D7C	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
2HV8 Crystal structure of GTP-bound Rab11 in complex with FIP3 Deposited 2006-07-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain D 695–756（62 aa） Fragment：C-terminal region	Not recorded	MG MAGNESIUM ION × 2 SO4 SULFATE ION × 2 GTP GUANOSINE-5'-TRIPHOSPHATE × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；20% PEG4000, 0.4M Ammonium Sulfate, 100mM MES, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 1.86 Å R-free 0.237
2HV8 Crystal structure of GTP-bound Rab11 in complex with FIP3 Deposited 2006-07-27	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain E 695–756（62 aa） Fragment：C-terminal region Chain F 695–756（62 aa） Fragment：C-terminal region	Not recorded	MG MAGNESIUM ION × 2 SO4 SULFATE ION × 4 GTP GUANOSINE-5'-TRIPHOSPHATE × 2 2ME METHOXYETHANE × 1 MES 2-(N-MORPHOLINO)-ETHANESULFONIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；277 K；20% PEG4000, 0.4M Ammonium Sulfate, 100mM MES, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 1.86 Å R-free 0.237
4D0M Phosphatidylinositol 4-kinase III beta in a complex with Rab11a-GTP- gamma-S and the Rab-binding domain of FIP3 Deposited 2014-04-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain E 713–756（44 aa） Fragment：RAB-BINDING DOMAIN Chain F 713–756（44 aa） Fragment：RAB-BINDING DOMAIN Chain U 713–756（44 aa） Fragment：RAB-BINDING DOMAIN Chain V 713–756（44 aa） Fragment：RAB-BINDING DOMAIN	Mutation：YES Mutation：YES Mutation：YES Mutation：YES	093 N-(5-(4-CHLORO-3-(2-HYDROXY-ETHYLSULFAMOYL)- PHENYLTHIAZOLE-2-YL)-ACETAMIDE × 4 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 4 MG MAGNESIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions 16% PEG 6K, 0.01 M NA CITRATE	Resolution 6.00 Å R-free 0.359
4D0M Phosphatidylinositol 4-kinase III beta in a complex with Rab11a-GTP- gamma-S and the Rab-binding domain of FIP3 Deposited 2014-04-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain K 713–756（44 aa） Fragment：RAB-BINDING DOMAIN Chain L 713–756（44 aa） Fragment：RAB-BINDING DOMAIN Chain e 713–756（44 aa） Fragment：RAB-BINDING DOMAIN Chain f 713–756（44 aa） Fragment：RAB-BINDING DOMAIN	Mutation：YES Mutation：YES Mutation：YES Mutation：YES	093 N-(5-(4-CHLORO-3-(2-HYDROXY-ETHYLSULFAMOYL)- PHENYLTHIAZOLE-2-YL)-ACETAMIDE × 4 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 4 MG MAGNESIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions 16% PEG 6K, 0.01 M NA CITRATE	Resolution 6.00 Å R-free 0.359
4D0M Phosphatidylinositol 4-kinase III beta in a complex with Rab11a-GTP- gamma-S and the Rab-binding domain of FIP3 Deposited 2014-04-29	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 12 PDB declaration: dodecameric	Chain a 713–756（44 aa） Fragment：RAB-BINDING DOMAIN Chain b 713–756（44 aa） Fragment：RAB-BINDING DOMAIN Chain i 713–756（44 aa） Fragment：RAB-BINDING DOMAIN Chain j 713–756（44 aa） Fragment：RAB-BINDING DOMAIN	Mutation：YES Mutation：YES Mutation：YES Mutation：YES	093 N-(5-(4-CHLORO-3-(2-HYDROXY-ETHYLSULFAMOYL)- PHENYLTHIAZOLE-2-YL)-ACETAMIDE × 4 GSP 5'-GUANOSINE-DIPHOSPHATE-MONOTHIOPHOSPHATE × 4 MG MAGNESIUM ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions 16% PEG 6K, 0.01 M NA CITRATE	Resolution 6.00 Å R-free 0.359
4UJ3 Crystal structure of human Rab11-Rabin8-FIP3 Deposited 2015-04-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 695–756（62 aa） Fragment：C-TERMINAL DOMAIN	Not recorded	GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.6；50MM MES PH 5.6, 0.2M AMMONIUM SULFATE AND 12% PEG 8000	Resolution 3.00 Å R-free 0.250
4UJ3 Crystal structure of human Rab11-Rabin8-FIP3 Deposited 2015-04-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain F 695–756（62 aa） Fragment：C-TERMINAL DOMAIN	Not recorded	GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.6；50MM MES PH 5.6, 0.2M AMMONIUM SULFATE AND 12% PEG 8000	Resolution 3.00 Å R-free 0.250
4UJ3 Crystal structure of human Rab11-Rabin8-FIP3 Deposited 2015-04-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain I 695–756（62 aa） Fragment：C-TERMINAL DOMAIN	Not recorded	GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.6；50MM MES PH 5.6, 0.2M AMMONIUM SULFATE AND 12% PEG 8000	Resolution 3.00 Å R-free 0.250
4UJ3 Crystal structure of human Rab11-Rabin8-FIP3 Deposited 2015-04-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain L 695–756（62 aa） Fragment：C-TERMINAL DOMAIN	Not recorded	GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.6；50MM MES PH 5.6, 0.2M AMMONIUM SULFATE AND 12% PEG 8000	Resolution 3.00 Å R-free 0.250
4UJ3 Crystal structure of human Rab11-Rabin8-FIP3 Deposited 2015-04-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain O 695–756（62 aa） Fragment：C-TERMINAL DOMAIN	Not recorded	GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 MG MAGNESIUM ION × 1 SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.6；50MM MES PH 5.6, 0.2M AMMONIUM SULFATE AND 12% PEG 8000	Resolution 3.00 Å R-free 0.250
4UJ3 Crystal structure of human Rab11-Rabin8-FIP3 Deposited 2015-04-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain R 695–756（62 aa） Fragment：C-TERMINAL DOMAIN	Not recorded	GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.6；50MM MES PH 5.6, 0.2M AMMONIUM SULFATE AND 12% PEG 8000	Resolution 3.00 Å R-free 0.250
4UJ3 Crystal structure of human Rab11-Rabin8-FIP3 Deposited 2015-04-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 7 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain U 695–756（62 aa） Fragment：C-TERMINAL DOMAIN	Not recorded	GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.6；50MM MES PH 5.6, 0.2M AMMONIUM SULFATE AND 12% PEG 8000	Resolution 3.00 Å R-free 0.250
4UJ3 Crystal structure of human Rab11-Rabin8-FIP3 Deposited 2015-04-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 8 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain X 695–756（62 aa） Fragment：C-TERMINAL DOMAIN	Not recorded	GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 MG MAGNESIUM ION × 1 PG4 TETRAETHYLENE GLYCOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.6；50MM MES PH 5.6, 0.2M AMMONIUM SULFATE AND 12% PEG 8000	Resolution 3.00 Å R-free 0.250
4UJ4 Crystal structure of human Rab11-Rabin8-FIP3 Deposited 2015-04-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain F 695–756（62 aa） Fragment：C-TERMINAL DOMAIN, RESIDUES 695-756 Chain I 695–756（62 aa） Fragment：C-TERMINAL DOMAIN, RESIDUES 695-756	Not recorded	GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2 MG MAGNESIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.8；50MM MES PH 5.8, 0.2M AMMONIUM SULFATE AND 14% PEG 8000	Resolution 4.20 Å R-free 0.266
4UJ4 Crystal structure of human Rab11-Rabin8-FIP3 Deposited 2015-04-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 695–756（62 aa） Fragment：C-TERMINAL DOMAIN, RESIDUES 695-756 Chain L 695–756（62 aa） Fragment：C-TERMINAL DOMAIN, RESIDUES 695-756	Not recorded	GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2 MG MAGNESIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.8；50MM MES PH 5.8, 0.2M AMMONIUM SULFATE AND 14% PEG 8000	Resolution 4.20 Å R-free 0.266
4UJ4 Crystal structure of human Rab11-Rabin8-FIP3 Deposited 2015-04-08	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 695–756（62 aa） Fragment：C-TERMINAL DOMAIN, RESIDUES 695-756 Chain L 695–756（62 aa） Fragment：C-TERMINAL DOMAIN, RESIDUES 695-756	Not recorded	GNP PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 2 MG MAGNESIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.8；50MM MES PH 5.8, 0.2M AMMONIUM SULFATE AND 14% PEG 8000	Resolution 4.20 Å R-free 0.266

4 other PDB entries and 16 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	RFIP3_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain C； PDBConstruct 1–42； UniProt 715–756 Author chain D； PDBConstruct 1–42； UniProt 715–756

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2d7c
Deposition date deposition_date	2005-11-16
Structure title title	Crystal structure of human Rab11 in complex with FIP3 Rab-binding domain
Keywords keywords	GTP-ase, coiled-coil, PROTEIN TRANSPORT, Structural Genomics; PROTEIN TRANSPORT
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	27.26 Å
Radius of gyration Rg (electron density) rg_electron	26.69 Å
Forward intensity I(0) i0	42228900.00
Molecular weight molecular_weight	49150.0 kDa
Excluded volume excluded_volume	60986 Å³
Envelope volume envelope_volume	74805 Å³
Hydration-shell volume shell_volume	24633 Å³
Envelope diameter envelope_diameter	88.6 Å
Shell Rg shell_rg	32.59 Å
Envelope Rg envelope_rg	26.48 Å
Shape Rg shape_rg	26.72 Å
Total Rg total_rg	27.25 Å
Total atoms total_atoms	3434
Residues n_residues	412
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	85.2 Å
Rg (real space) rg_real	27.39 Å
Rg uncertainty (real space) rg_real_error	0.56 Å
I(0) (real space) i0_real	4.2230e+07
I(0) uncertainty (real space) i0_real_error	5.4860e+05
Rg (reciprocal space) rg_reciprocal	27.35 Å
I(0) (reciprocal space) i0_reciprocal	42230000.0000
Solution quality estimate total_estimate	0.8865
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	26.4 Å
Skewness Skewness skewness	0.390
Kurtosis Kurtosis kurtosis	-0.594
Angular range angular_range	— – 0.2900 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	5703000.0000
Real-space data points n_real_points	59
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.913; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.932; Smooth: 0.851

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	Ras-related protein Rab-11A
Molecular weight formula_weight	18871.1 kDa
Mutation mutation	Q70L
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B
Atom count atom_count	3844

EYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGLERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIY

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli BL21

Entity 2 Entity 2 polymer

Description description	Rab11 family-interacting protein 3
Molecular weight formula_weight	5090.5 kDa
Source method src_method	man
Copy count entity_count	2

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,D

VSRDELMEAIQKQEEINFRLQDYIDRIIVAIMETNPSILEVK

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli BL21

Entity 3 Entity 3 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 4 Entity 4 non-polymer

Description description	GUANOSINE-5'-TRIPHOSPHATE
Molecular weight formula_weight	523.2 kDa
Source method src_method	syn
Copy count entity_count	2

Entity 5 Entity 5 non-polymer

Description description	2-(N-MORPHOLINO)-ETHANESULFONIC ACID
Molecular weight formula_weight	195.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 6 Entity 6 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	410

▼

7. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

Domain ID domain_id	d2d7ca_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.37 — P-loop containing nucleoside triphosphate hydrolases
Superfamily Superfamily superfamily	c.37.1 — P-loop containing nucleoside triphosphate hydrolases
Family Family family	c.37.1.8 — G proteins

Domain ID domain_id	d2d7cb_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.37 — P-loop containing nucleoside triphosphate hydrolases
Superfamily Superfamily superfamily	c.37.1 — P-loop containing nucleoside triphosphate hydrolases
Family Family family	c.37.1.8 — G proteins

Domain ID domain_id	d2d7cc1
Class class	h — Coiled coil proteins
Fold Fold fold	h.1 — Parallel coiled-coil
Superfamily Superfamily superfamily	h.1.31 — Eferin C-derminal domain-like
Family Family family	h.1.31.1 — Eferin C-derminal domain-like

Domain ID domain_id	d2d7cd_
Class class	h — Coiled coil proteins
Fold Fold fold	h.1 — Parallel coiled-coil
Superfamily Superfamily superfamily	h.1.31 — Eferin C-derminal domain-like
Family Family family	h.1.31.1 — Eferin C-derminal domain-like

CATH v4.4 (4 domains)

Domain ID domain_id	2d7cA00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	2d7cB00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	2d7cC00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	2440 —

Domain ID domain_id	2d7cD00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	2440 —

▶

8. Citations (1)

▶

Unit-cell length a length_a	108.717 Å
Unit-cell length b length_b	120.565 Å
Unit-cell length c length_c	36.249 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 21 21 2
Space-group number int_tables_number	18
Crystal system crystal_system	—

Resolution resolution	1.750 Å
Low-resolution limit resolution_low	40.000 Å
R factor r_factor	0.2030
R_work r_work	0.2020
R_free r_free	0.2240

fit	/app/data/saxs_computation/d7/2d7c/2d7c.fit
pddf	/app/data/pr_computation/d7/2d7c/2d7c.pr.out
profile	/app/data/saxs_computation/d7/2d7c/2d7c.dat

Crystal structure of human Rab11 in complex with FIP3 Rab-binding domain

1. Protein Identity and Related Structures Protein Identity & Related Structures

Ras-related protein Rab-11A

State in the Current Structure

Other States of the Same Protein in the Database

Rab11 family-interacting protein 3

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

6. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

7. Fold Classification (SCOP + CATH) 8 domains

SCOP 2.08 (4 domains)

CATH v4.4 (4 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)