4uj3

Crystal structure of human Rab11-Rabin8-FIP3

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

RAS-RELATED PROTEIN RAB-11A

HOMO SAPIENS

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	RAB-3A-INTERACTING PROTEIN × 1 （Q96QF0） RAB11 FAMILY-INTERACTING PROTEIN 3 × 1 （O75154） PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 MAGNESIUM ION × 1 water × 3	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 3	RAB-3A-INTERACTING PROTEIN × 1 （Q96QF0） RAB11 FAMILY-INTERACTING PROTEIN 3 × 1 （O75154） PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 MAGNESIUM ION × 1 water × 3	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 3	RAB-3A-INTERACTING PROTEIN × 1 （Q96QF0） RAB11 FAMILY-INTERACTING PROTEIN 3 × 1 （O75154） PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 MAGNESIUM ION × 1 water × 2	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 3	RAB-3A-INTERACTING PROTEIN × 1 （Q96QF0） RAB11 FAMILY-INTERACTING PROTEIN 3 × 1 （O75154） PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 MAGNESIUM ION × 1 water × 2	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 3	RAB-3A-INTERACTING PROTEIN × 1 （Q96QF0） RAB11 FAMILY-INTERACTING PROTEIN 3 × 1 （O75154） PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 MAGNESIUM ION × 1 SULFATE ION × 1 water × 1	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 3	RAB-3A-INTERACTING PROTEIN × 1 （Q96QF0） RAB11 FAMILY-INTERACTING PROTEIN 3 × 1 （O75154） PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 MAGNESIUM ION × 1 water × 3	Consistent with protein count
7	Protein heterocomplex	Heteromer	Protein 3	RAB-3A-INTERACTING PROTEIN × 1 （Q96QF0） RAB11 FAMILY-INTERACTING PROTEIN 3 × 1 （O75154） PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 MAGNESIUM ION × 1 water × 3	Consistent with protein count
8	Protein heterocomplex	Heteromer	Protein 3	RAB-3A-INTERACTING PROTEIN × 1 （Q96QF0） RAB11 FAMILY-INTERACTING PROTEIN 3 × 1 （O75154） PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 MAGNESIUM ION × 1 TETRAETHYLENE GLYCOL × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RB11A_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 5–187； UniProt 4–186 Author chain D； PDBConstruct 5–187； UniProt 4–186 Author chain G； PDBConstruct 5–187； UniProt 4–186 Author chain J； PDBConstruct 5–187； UniProt 4–186 Author chain M； PDBConstruct 5–187； UniProt 4–186 Author chain P； PDBConstruct 5–187； UniProt 4–186 Author chain S； PDBConstruct 5–187； UniProt 4–186 Author chain V； PDBConstruct 5–187； UniProt 4–186

RAB-3A-INTERACTING PROTEIN

HOMO SAPIENS

UniProt Q96QF0

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	RAS-RELATED PROTEIN RAB-11A × 1 （P62491） RAB11 FAMILY-INTERACTING PROTEIN 3 × 1 （O75154） PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 MAGNESIUM ION × 1 water × 3	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 3	RAS-RELATED PROTEIN RAB-11A × 1 （P62491） RAB11 FAMILY-INTERACTING PROTEIN 3 × 1 （O75154） PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 MAGNESIUM ION × 1 water × 3	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 3	RAS-RELATED PROTEIN RAB-11A × 1 （P62491） RAB11 FAMILY-INTERACTING PROTEIN 3 × 1 （O75154） PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 MAGNESIUM ION × 1 water × 2	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 3	RAS-RELATED PROTEIN RAB-11A × 1 （P62491） RAB11 FAMILY-INTERACTING PROTEIN 3 × 1 （O75154） PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 MAGNESIUM ION × 1 water × 2	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 3	RAS-RELATED PROTEIN RAB-11A × 1 （P62491） RAB11 FAMILY-INTERACTING PROTEIN 3 × 1 （O75154） PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 MAGNESIUM ION × 1 SULFATE ION × 1 water × 1	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 3	RAS-RELATED PROTEIN RAB-11A × 1 （P62491） RAB11 FAMILY-INTERACTING PROTEIN 3 × 1 （O75154） PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 MAGNESIUM ION × 1 water × 3	Consistent with protein count
7	Protein heterocomplex	Heteromer	Protein 3	RAS-RELATED PROTEIN RAB-11A × 1 （P62491） RAB11 FAMILY-INTERACTING PROTEIN 3 × 1 （O75154） PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 MAGNESIUM ION × 1 water × 3	Consistent with protein count
8	Protein heterocomplex	Heteromer	Protein 3	RAS-RELATED PROTEIN RAB-11A × 1 （P62491） RAB11 FAMILY-INTERACTING PROTEIN 3 × 1 （O75154） PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 MAGNESIUM ION × 1 TETRAETHYLENE GLYCOL × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RAB3I_HUMAN
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 5–195； UniProt 286–476 Author chain E； PDBConstruct 5–195； UniProt 286–476 Author chain H； PDBConstruct 5–195； UniProt 286–476 Author chain K； PDBConstruct 5–195； UniProt 286–476 Author chain N； PDBConstruct 5–195； UniProt 286–476 Author chain Q； PDBConstruct 5–195； UniProt 286–476 Author chain T； PDBConstruct 5–195； UniProt 286–476 Author chain W； PDBConstruct 5–195； UniProt 286–476

RAB11 FAMILY-INTERACTING PROTEIN 3

HOMO SAPIENS

UniProt O75154

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein heterocomplex	Heteromer	Protein 3	RAS-RELATED PROTEIN RAB-11A × 1 （P62491） RAB-3A-INTERACTING PROTEIN × 1 （Q96QF0） PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 MAGNESIUM ION × 1 water × 3	Consistent with protein count
2	Protein heterocomplex	Heteromer	Protein 3	RAS-RELATED PROTEIN RAB-11A × 1 （P62491） RAB-3A-INTERACTING PROTEIN × 1 （Q96QF0） PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 MAGNESIUM ION × 1 water × 3	Consistent with protein count
3	Protein heterocomplex	Heteromer	Protein 3	RAS-RELATED PROTEIN RAB-11A × 1 （P62491） RAB-3A-INTERACTING PROTEIN × 1 （Q96QF0） PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 MAGNESIUM ION × 1 water × 2	Consistent with protein count
4	Protein heterocomplex	Heteromer	Protein 3	RAS-RELATED PROTEIN RAB-11A × 1 （P62491） RAB-3A-INTERACTING PROTEIN × 1 （Q96QF0） PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 MAGNESIUM ION × 1 water × 2	Consistent with protein count
5	Protein heterocomplex	Heteromer	Protein 3	RAS-RELATED PROTEIN RAB-11A × 1 （P62491） RAB-3A-INTERACTING PROTEIN × 1 （Q96QF0） PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 MAGNESIUM ION × 1 SULFATE ION × 1 water × 1	Consistent with protein count
6	Protein heterocomplex	Heteromer	Protein 3	RAS-RELATED PROTEIN RAB-11A × 1 （P62491） RAB-3A-INTERACTING PROTEIN × 1 （Q96QF0） PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 MAGNESIUM ION × 1 water × 3	Consistent with protein count
7	Protein heterocomplex	Heteromer	Protein 3	RAS-RELATED PROTEIN RAB-11A × 1 （P62491） RAB-3A-INTERACTING PROTEIN × 1 （Q96QF0） PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 MAGNESIUM ION × 1 water × 3	Consistent with protein count
8	Protein heterocomplex	Heteromer	Protein 3	RAS-RELATED PROTEIN RAB-11A × 1 （P62491） RAB-3A-INTERACTING PROTEIN × 1 （Q96QF0） PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER × 1 MAGNESIUM ION × 1 TETRAETHYLENE GLYCOL × 1 water × 2	Consistent with protein count

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	RFIP3_HUMAN
Isoform	—
PDB entities	3
Chains and sequence ranges	Author chain C； PDBConstruct 5–66； UniProt 695–756 Author chain F； PDBConstruct 5–66； UniProt 695–756 Author chain I； PDBConstruct 5–66； UniProt 695–756 Author chain L； PDBConstruct 5–66； UniProt 695–756 Author chain O； PDBConstruct 5–66； UniProt 695–756 Author chain R； PDBConstruct 5–66； UniProt 695–756 Author chain U； PDBConstruct 5–66； UniProt 695–756 Author chain X； PDBConstruct 5–66； UniProt 695–756

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	4uj3
Deposition date deposition_date	2015-04-08
Structure title title	Crystal structure of human Rab11-Rabin8-FIP3
Keywords keywords	TRANSPORT PROTEIN, CILIARY TARGETING COMPLEX, CILIUM, VESICULAR TRANSPORT, MEMBRANE TRAFFICKING; TRANSPORT PROTEIN
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

4uj3__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

4uj3__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

4uj3__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	24.64 Å
Rg (electron density)	23.78 Å
Total Rg	24.65 Å
Atom count	2951
Residues	373
Excluded volume	52384 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`4uj3__assembly_1__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`4uj3__assembly_2__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`4uj3__assembly_3__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`4uj3__assembly_4__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
5	1	`4uj3__assembly_5__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
6	1	`4uj3__assembly_6__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
7	1	`4uj3__assembly_7__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
8	1	`4uj3__assembly_8__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Description description	RAS-RELATED PROTEIN RAB-11A
Molecular weight formula_weight	21116.7 kDa
Mutation mutation	YES
Source method src_method	man
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,D,G,J,M,P,S,V
Atom count atom_count	23392

GAASRDDEYDYLFKVVLIGDSGVGKSNLLSRFTRNEFNLESKSTIGVEFATRSIQVDGKTIKAQIWDTAGLERYRAITSAYYRGAVGALLVYDIAKHLTYENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRIVSQKQMSDRRE

Source Source

Source organism organism	HOMO SAPIENS
Common name common_name	HUMAN
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	ESCHERICHIA COLI

Entity 2 Entity 2 polymer

Description description	RAB-3A-INTERACTING PROTEIN
Molecular weight formula_weight	22217.5 kDa
Source method src_method	man
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B,E,H,K,N,Q,T,W

GAASNKSTSSAMSGSHQDLSVIQPIVKDCKEADLSLYNEFRLWKDEPTMDRTCPFLDKIYQEDIFPCLTFSKSELASAVLEAVENNTLSIEPVGLQPIRFVKASAVECGGPKKCALTGQSKSCKHRIKLGDSSNYYYISPFCRYRITSVCNFFTYIRYIQQGLVKQQDVDQMFWEVMQLRKEMSLAKLGYFKEEL

Source Source

Source organism organism	HOMO SAPIENS
Common name common_name	HUMAN
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	ESCHERICHIA COLI

Entity 3 Entity 3 polymer

Description description	RAB11 FAMILY-INTERACTING PROTEIN 3
Molecular weight formula_weight	7269.2 kDa
Source method src_method	man
Copy count entity_count	8

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	C,F,I,L,O,R,U,X

GAASGAKSLFSTAFSESLAAEISSVSRDELMEAIQKQEEINFRLQDYIDRIIVAIMETNPSILEVK

Source Source

Source organism organism	HOMO SAPIENS
Common name common_name	HUMAN
NCBI taxonomy ID ncbi_taxonomy_id	9606
Host organism host_organism	ESCHERICHIA COLI

Entity 4 Entity 4 non-polymer

Description description	PHOSPHOAMINOPHOSPHONIC ACID-GUANYLATE ESTER
Molecular weight formula_weight	522.2 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 5 Entity 5 non-polymer

Description description	MAGNESIUM ION
Molecular weight formula_weight	24.3 kDa
Source method src_method	syn
Copy count entity_count	8

Entity 6 Entity 6 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 7 Entity 7 non-polymer

Description description	TETRAETHYLENE GLYCOL
Molecular weight formula_weight	194.2 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 8 Entity 8 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	108

▼

6. Fold Classification (SCOP + CATH) 23 domains

SCOP 2.08 (14 domains)

Domain ID domain_id	d4uj3a_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.37 — P-loop containing nucleoside triphosphate hydrolases
Superfamily Superfamily superfamily	c.37.1 — P-loop containing nucleoside triphosphate hydrolases
Family Family family	c.37.1.0 — automated matches

Domain ID domain_id	d4uj3d_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.37 — P-loop containing nucleoside triphosphate hydrolases
Superfamily Superfamily superfamily	c.37.1 — P-loop containing nucleoside triphosphate hydrolases
Family Family family	c.37.1.0 — automated matches

Domain ID domain_id	d4uj3f_
Class class	h — Coiled coil proteins
Fold Fold fold	h.1 — Parallel coiled-coil
Superfamily Superfamily superfamily	h.1.31 — Eferin C-derminal domain-like
Family Family family	h.1.31.1 — Eferin C-derminal domain-like

Domain ID domain_id	d4uj3g_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.37 — P-loop containing nucleoside triphosphate hydrolases
Superfamily Superfamily superfamily	c.37.1 — P-loop containing nucleoside triphosphate hydrolases
Family Family family	c.37.1.0 — automated matches

Domain ID domain_id	d4uj3i_
Class class	h — Coiled coil proteins
Fold Fold fold	h.1 — Parallel coiled-coil
Superfamily Superfamily superfamily	h.1.31 — Eferin C-derminal domain-like
Family Family family	h.1.31.1 — Eferin C-derminal domain-like

Domain ID domain_id	d4uj3j_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.37 — P-loop containing nucleoside triphosphate hydrolases
Superfamily Superfamily superfamily	c.37.1 — P-loop containing nucleoside triphosphate hydrolases
Family Family family	c.37.1.0 — automated matches

Domain ID domain_id	d4uj3l_
Class class	h — Coiled coil proteins
Fold Fold fold	h.1 — Parallel coiled-coil
Superfamily Superfamily superfamily	h.1.31 — Eferin C-derminal domain-like
Family Family family	h.1.31.1 — Eferin C-derminal domain-like

Domain ID domain_id	d4uj3m_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.37 — P-loop containing nucleoside triphosphate hydrolases
Superfamily Superfamily superfamily	c.37.1 — P-loop containing nucleoside triphosphate hydrolases
Family Family family	c.37.1.0 — automated matches

Domain ID domain_id	d4uj3o_
Class class	h — Coiled coil proteins
Fold Fold fold	h.1 — Parallel coiled-coil
Superfamily Superfamily superfamily	h.1.31 — Eferin C-derminal domain-like
Family Family family	h.1.31.1 — Eferin C-derminal domain-like

Domain ID domain_id	d4uj3p_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.37 — P-loop containing nucleoside triphosphate hydrolases
Superfamily Superfamily superfamily	c.37.1 — P-loop containing nucleoside triphosphate hydrolases
Family Family family	c.37.1.0 — automated matches

Domain ID domain_id	d4uj3r_
Class class	h — Coiled coil proteins
Fold Fold fold	h.1 — Parallel coiled-coil
Superfamily Superfamily superfamily	h.1.31 — Eferin C-derminal domain-like
Family Family family	h.1.31.1 — Eferin C-derminal domain-like

Domain ID domain_id	d4uj3s_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.37 — P-loop containing nucleoside triphosphate hydrolases
Superfamily Superfamily superfamily	c.37.1 — P-loop containing nucleoside triphosphate hydrolases
Family Family family	c.37.1.0 — automated matches

Domain ID domain_id	d4uj3u_
Class class	h — Coiled coil proteins
Fold Fold fold	h.1 — Parallel coiled-coil
Superfamily Superfamily superfamily	h.1.31 — Eferin C-derminal domain-like
Family Family family	h.1.31.1 — Eferin C-derminal domain-like

Domain ID domain_id	d4uj3v_
Class class	c — Alpha and beta proteins (a/b)
Fold Fold fold	c.37 — P-loop containing nucleoside triphosphate hydrolases
Superfamily Superfamily superfamily	c.37.1 — P-loop containing nucleoside triphosphate hydrolases
Family Family family	c.37.1.0 — automated matches

CATH v4.4 (9 domains)

Domain ID domain_id	4uj3A00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	4uj3D00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	4uj3G00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	4uj3I00
Class class	1 — Mainly Alpha
Architecture architecture	20 — Up-down Bundle
Topology topology	5 — Single alpha-helices involved in coiled-coils or other helix-helix interfaces
Homologous superfamily homologous superfamily	2440 —

Domain ID domain_id	4uj3J00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	4uj3M00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	4uj3P00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	4uj3S00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

Domain ID domain_id	4uj3V00
Class class	3 — Alpha Beta
Architecture architecture	40 — 3-Layer(aba) Sandwich
Topology topology	50 — Rossmann fold
Homologous superfamily homologous superfamily	300 — P-loop containing nucleotide triphosphate hydrolases

▶

Unit-cell length a length_a	67.498 Å
Unit-cell length b length_b	165.374 Å
Unit-cell length c length_c	218.687 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	95.93 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	16

Space group space_group	P 1 21 1
Space-group number int_tables_number	4
Crystal system crystal_system	—

Resolution resolution	3.000 Å
Low-resolution limit resolution_low	48.543 Å
R factor r_factor	0.2005
R_work r_work	0.1979
R_free r_free	0.2504

Crystal structure of human Rab11-Rabin8-FIP3

1. Protein Identity and Related Structures Protein Identity & Related Structures

RAS-RELATED PROTEIN RAB-11A

State in the Current Structure

Other States of the Same Protein in the Database

RAB-3A-INTERACTING PROTEIN

State in the Current Structure

Other States of the Same Protein in the Database

RAB11 FAMILY-INTERACTING PROTEIN 3

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4uj3__assembly_1__model_1

4uj3__assembly_1__model_1 | I(q)

4uj3__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 water

6. Fold Classification (SCOP + CATH) 23 domains

SCOP 2.08 (14 domains)

CATH v4.4 (9 domains)

7. Citations (1)

Crystal structure of human Rab11-Rabin8-FIP3

1. Protein Identity and Related Structures Protein Identity & Related Structures

RAS-RELATED PROTEIN RAB-11A

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RAB-3A-INTERACTING PROTEIN

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

RAB11 FAMILY-INTERACTING PROTEIN 3

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

4uj3__assembly_1__model_1

4uj3__assembly_1__model_1 | I(q)

4uj3__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (8)

Entity 1 Entity 1 polymer

Polymer Polymer

Source Source

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 polymer

Polymer Polymer

Source Source

Entity 4 Entity 4 non-polymer

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 non-polymer

Entity 7 Entity 7 non-polymer

Entity 8 Entity 8 water

6. Fold Classification (SCOP + CATH) 23 domains

SCOP 2.08 (14 domains)

CATH v4.4 (9 domains)

7. Citations (1)