SAXSdb — 2dyf

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Huntingtin-interacting protein HYPA/FBP11

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 146–173	Fragment：THE FIRST WW DOMAIN	PL (PPLP) motif peptide from Myosin tail region-interacting protein MTI1 × 1 （P47068）	SOLUTION NMR NMR measurement conditions：pH 5；283 K；Ionic strength (raw mmCIF value) 0.3；Pressure 1 NMR sample composition：1.5MM FBP11 WW1 U-15N, 13C 5.3MM NATURAL ABUNDANCE PL MOTIF PEPTIDE; 50MM PHOSPHATE BUFFER NA; 50MM NACL; 90% H2O, 10% D2O; 1.5MM FBP11 WW1 U- 15N, 13C; 5.3MM NATURAL ABUNDANCE PL MOTIF PEPTIDE; 50MM PHOSPHATE BUFFER NA; 50MM NACL; 100% D2O; 1.6MM FBP11 WW1 NATURAL ABUNDANCE; 4.4MM PL MOTIF PEPTIDE U-15N, 13C; 50MM PHOSPHATE BUFFER NA; 50MM NACL; 90% H2O, 10% D2O; 1.6MM FBP11 WW1 NATURAL ABUNDANCE; 4.4MM PL MOTIF PEPTIDE U-15N, 13C; 50MM PHOSPHATE BUFFER NA; 50MM NACL; 100% D2O; 1.5MM FBP11 WW1 U-15N; 5.3MM NATURAL ABUNDANCE PL MOTIF PEPTIDE; 50MM PHOSPHATE BUFFER NA; 50MM NACL; 90% H2O, 10% D2O	Resolution not provided

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 2DYF	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1YWI Structure of the FBP11WW1 domain complexed to the peptide APPTPPPLPP Deposited 2005-02-18	Different construct Different experimental conditions	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 142–173（32 aa） Fragment：WW1 domain	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6；298 K；Ionic strength (raw mmCIF value) 100mM NaCl；Pressure 1 NMR sample composition 1.8mM [U-15N,13C] FBP11WW1, 3.6mM APPTPPPLPP, 10mM phosphate buffer, 100mM Nacl, 0.1mM DTT, 0.1mM EDTA \| 90% H2O/10% D2O NMR sample composition 1.8mM [U-15N,13C] FBP11WW1, 3.6mM APPTPPPLPP, 10mM phosphate buffer, 100mM Nacl, 0.1mM DTT, 0.1mM EDTA \| 100% D2O NMR sample composition 1.8mM [U-15N] FBP11WW1, 3.6mM APPTPPPLPP, 10mM phosphate buffer, 100mM Nacl, 0.1mM DTT, 0.1mM EDTA \| 90% H2O/10% D2O NMR sample composition 1.8mM FBP11WW1, 3.6mM APPTPPPLPP, 10mM phosphate buffer, 100mM Nacl, 0.1mM DTT, 0.1mM EDTA \| 90% H2O/10% D2O	Resolution not provided
1YWJ Structure of the FBP11WW1 domain Deposited 2005-02-18	Different construct Different oligomeric state Different experimental conditions	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 142–173（32 aa） Fragment：WW1 domain	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6；298 K；Ionic strength (raw mmCIF value) 100mM NaCl；Pressure 1 NMR sample composition 1.8mM [U-15N,13C] FBP11WW1, 10mM phosphate buffer, 100mM Nacl, 0.1mM DTT, 0.1mM EDTA \| 90% H2O/10% D2O NMR sample composition 1.8mM [U-15N,13C] FBP11WW1, 10mM phosphate buffer, 100mM Nacl, 0.1mM DTT, 0.1mM EDTA \| 100% D2O NMR sample composition 1.8mM [U-15N] FBP11WW1, 10mM phosphate buffer, 100mM Nacl, 0.1mM DTT, 0.1mM EDTA \| 90% H2O/10% D2O NMR sample composition 1.8mM FBP11WW1, 10mM phosphate buffer, 100mM Nacl, 0.1mM DTT, 0.1mM EDTA \| 90% H2O/10% D2O	Resolution not provided
2CQN Solution structure of the FF domain of human Formin-binding protein 3 Deposited 2005-05-20	Different construct Different oligomeric state Different experimental conditions	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 743–806（64 aa） Fragment：FF domain	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 7；298 K；Ionic strength (raw mmCIF value) 120mM；Pressure ambient NMR sample composition 1.9mM 13C/15N-PROTEIN; 20mM d-Tris-HCl; 100mM NaCl; 1mM d-DTT; 0.02% NaN3 \| 90% H2O/10% D2O	Resolution not provided
2KZG A Transient and Low Populated Protein Folding Intermediate at Atomic Resolution Deposited 2010-06-17	Different construct Different oligomeric state Different experimental conditions	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 381–450（70 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 5.7；303 K；Ionic strength (raw mmCIF value) 145；Pressure ambient NMR sample composition 1-2 mM [U-13C; U-15N; U-2H] FF-1, 100 mM sodium chloride-2, 50 mM sodium acetate-3, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 1-2 mM [U-100% 13C; U-100% 15N; U-50% 2H] FF-4, 100 mM sodium chloride-5, 50 mM sodium acetate-6, 100% D2O \| 100% D2O NMR sample composition 1-2 mM [selective 13C; U-100% 15N] FF-7, 100 mM sodium chloride-8, 50 mM sodium acetate-9, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
2L5F Solution structure of the tandem WW domains from HYPA/FBP11 Deposited 2010-11-01	Different construct Different mutation/modification Different oligomeric state Different experimental conditions	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 133–220（88 aa） Fragment：WW domains (UNP RESIDUES 133-220)	Mutation：P67T	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6；298 K；Ionic strength (raw mmCIF value) 0.11；Pressure ambient NMR sample composition 10 mM sodium phosphate-1, 100 mM sodium chloride-2, 5 mM DTT-3, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided
2L9V NMR structure of the FF domain L24A mutant's folding transition state Deposited 2011-02-24	Different construct Different mutation/modification Different oligomeric state Different experimental conditions	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 381–450（70 aa） Fragment：FF 1 domain residues 390-438	Mutation：L24A	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 5.7；303 K；Ionic strength (raw mmCIF value) 145；Pressure ambient NMR sample composition 1-2 mM [U-13C; U-15N; U-2H] protein, 100 mM sodium chloride, 50 mM sodium acetate, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 1-2 mM [U-100% 13C; U-100% 15N; U-50% 2H] protein, 100 mM sodium chloride, 50 mM sodium acetate, 100% D2O \| 100% D2O	Resolution not provided
2LKS Ff11-60 Deposited 2011-10-19	Different construct Different oligomeric state Different experimental conditions	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 391–439（49 aa） Fragment：FF 1 domain residues 391-439	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 4.8；298 K；Ionic strength (raw mmCIF value) 0.070；Pressure ambient NMR sample composition 20 mM sodium acetate, 50 mM sodium chloride, 0.05 % sodium azide, 1 mM [U-100% 13C; U-100% 15N] FF11, 95% H2O/5% D2O \| 95% H2O/5% D2O NMR sample composition 20 mM sodium acetate, 50 mM sodium chloride, 0.05 % sodium azide, 1 mM [U-100% 13C; U-100% 15N] FF11-60 A51L, 95% H2O/5% D2O \| 95% H2O/5% D2O NMR sample composition 20 mM 20mM sodium acetate, 50 mM 50 mM sodium chloride, 0.05 % 0.05% sodium azide, 1 mM [U-10% 13C; U-100% 15N] FF11, 95% H2O/5% D2O \| 95% H2O/5% D2O	Resolution not provided
8PXW Structure of the WW domain tandem of PRPF40A Deposited 2023-07-24	Different construct Different oligomeric state Different experimental conditions	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 141–236（96 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.5；298 K；Ionic strength (raw mmCIF value) 133；Pressure 1 NMR sample composition 390 uM [U-100% 13C; U-100% 15N] PRPF40A, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 390 uM [U-100% 13C; U-100% 15N] PRPF40A, 100% D2O \| 100% D2O	Resolution not provided
8PXX Structure of the WW domain tandem of PRPF40A in complex with SF1 Deposited 2023-07-24	Different construct Different experimental conditions	Assembly 1 Protein heterocomplex Heteromer；Protein × 2 PDB declaration: dimeric	Chain A 141–236（96 aa）	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6.5；308 K；Ionic strength (raw mmCIF value) 133；Pressure 1 NMR sample composition 590 uM [U-100% 13C; U-100% 15N] PRPF40A, 590 uM SF1, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 590 uM [U-100% 13C; U-100% 15N] PRPF40A, 590 uM SF1, 100% D2O \| 100% D2O NMR sample composition 900 uM [U-100% 13C; U-100% 15N] SF1, 900 uM PRPF40A, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 900 uM [U-100% 13C; U-100% 15N] SF1, 900 uM PRPF40A, 100% D2O \| 100% D2O NMR sample composition 150 uM [U-100% 15N] PRPF40A, 150 uM SF1, 90% H2O/10% D2O \| 90% H2O/10% D2O NMR sample composition 150 uM [U-100% 15N] PRPF40A, 150 uM SF1, 10 mg/mL Pf1 phage, 90% H2O/10% D2O \| 90% H2O/10% D2O	Resolution not provided

9 other PDB entries and 9 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	PRP40_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 3–30； UniProt 146–173

PL (PPLP) motif peptide from Myosin tail region-interacting protein MTI1

Saccharomyces cerevisiae

UniProt P47068

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein heterocomplex Heteromer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain B； UniProt 796–802	Not recorded	Huntingtin-interacting protein HYPA/FBP11 × 1 （O75400）	SOLUTION NMR NMR measurement conditions：pH 5；283 K；Ionic strength (raw mmCIF value) 0.3；Pressure 1 NMR sample composition：1.5MM FBP11 WW1 U-15N, 13C 5.3MM NATURAL ABUNDANCE PL MOTIF PEPTIDE; 50MM PHOSPHATE BUFFER NA; 50MM NACL; 90% H2O, 10% D2O; 1.5MM FBP11 WW1 U- 15N, 13C; 5.3MM NATURAL ABUNDANCE PL MOTIF PEPTIDE; 50MM PHOSPHATE BUFFER NA; 50MM NACL; 100% D2O; 1.6MM FBP11 WW1 NATURAL ABUNDANCE; 4.4MM PL MOTIF PEPTIDE U-15N, 13C; 50MM PHOSPHATE BUFFER NA; 50MM NACL; 90% H2O, 10% D2O; 1.6MM FBP11 WW1 NATURAL ABUNDANCE; 4.4MM PL MOTIF PEPTIDE U-15N, 13C; 50MM PHOSPHATE BUFFER NA; 50MM NACL; 100% D2O; 1.5MM FBP11 WW1 U-15N; 5.3MM NATURAL ABUNDANCE PL MOTIF PEPTIDE; 50MM PHOSPHATE BUFFER NA; 50MM NACL; 90% H2O, 10% D2O	Resolution not provided

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 2DYF	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1TG0 0.97-A structure of the SH3 domain of bbc1 Deposited 2004-05-28	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–68（68 aa） Fragment：sh3 domain	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7；295 K；3.2M ammonium sulfate, pH 7, VAPOR DIFFUSION, SITTING DROP, temperature 295K	Resolution 0.97 Å R-free 0.193
1WDX Yeast BBC1 SH3 domain, triclinic crystal form Deposited 2004-05-19	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 1–68（68 aa） Fragment：SH3 domain	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；3.2M ammonium sulfate, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.50 Å R-free 0.326
1WDX Yeast BBC1 SH3 domain, triclinic crystal form Deposited 2004-05-19	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 1–68（68 aa） Fragment：SH3 domain	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；3.2M ammonium sulfate, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.50 Å R-free 0.326
1WDX Yeast BBC1 SH3 domain, triclinic crystal form Deposited 2004-05-19	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 3 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain C 1–68（68 aa） Fragment：SH3 domain	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；3.2M ammonium sulfate, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.50 Å R-free 0.326
1WDX Yeast BBC1 SH3 domain, triclinic crystal form Deposited 2004-05-19	Different construct Different oligomeric state Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 4 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain D 1–68（68 aa） Fragment：SH3 domain	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；3.2M ammonium sulfate, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.50 Å R-free 0.326
1ZUK Yeast BBC1 Sh3 domain complexed with a peptide from Las17 Deposited 2005-05-31	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 1–68（68 aa） Fragment：SH3 domain Chain B 1–68（68 aa） Fragment：SH3 domain	Not recorded	CL CHLORIDE ION × 1 MG MAGNESIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；295 K；VAPOR DIFFUSION, HANGING DROP, temperature 295K	Resolution 1.90 Å R-free 0.226

3 other PDB entries and 6 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	BBC1_YEAST
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain B； PDBConstruct 3–9； UniProt 796–802

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2dyf
Deposition date deposition_date	2006-09-11
Structure title title	Solution structure of the first WW domain of FBP11 / HYPA (FBP11 WW1) complexed with a PL (PPLP) motif peptide ligand
Keywords keywords	;WW DOMAIN, COMPLEX, FBP11, HYPA, PL MOTIF, PPLP MOTIF, SOLUTION STRUCTURE, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, PROTEIN BINDING ;; PROTEIN BINDING
Experimental Method method	SOLUTION NMR

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	10.23 Å
Radius of gyration Rg (electron density) rg_electron	9.79 Å
Forward intensity I(0) i0	128471000.00
Molecular weight molecular_weight	89355.0 kDa
Excluded volume excluded_volume	109080 Å³
Envelope volume envelope_volume	12110 Å³
Hydration-shell volume shell_volume	8968 Å³
Envelope diameter envelope_diameter	39.1 Å
Shell Rg shell_rg	17.24 Å
Envelope Rg envelope_rg	12.15 Å
Shape Rg shape_rg	9.72 Å
Total Rg total_rg	10.27 Å
Total atoms total_atoms	12040
Residues n_residues	780
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	36.2 Å
Rg (real space) rg_real	10.22 Å
Rg uncertainty (real space) rg_real_error	0.31 Å
I(0) (real space) i0_real	1.2850e+08
I(0) uncertainty (real space) i0_real_error	1.5060e+06
Rg (reciprocal space) rg_reciprocal	10.22 Å
I(0) (reciprocal space) i0_reciprocal	128500000.0000
Solution quality estimate total_estimate	0.8613
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	12.4 Å
Skewness Skewness skewness	0.297
Kurtosis Kurtosis kurtosis	-0.199
Angular range angular_range	— – 0.5000 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	37090.0000
Real-space data points n_real_points	80
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.768; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.939; Smooth: 0.952

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Description description	Huntingtin-interacting protein HYPA/FBP11
Molecular weight formula_weight	3612.8 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	12040

GSWTEHKSPDGRTYYYNTETKQSTWEKPDD

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 polymer

Description description	PL (PPLP) motif peptide from Myosin tail region-interacting protein MTI1
Molecular weight formula_weight	896.0 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

GSTAPPLPR

来源 Source

来源生物 organism	Saccharomyces cerevisiae
通用名 common_name	;baker's yeast ;
NCBI Class编号 ncbi_taxonomy_id	4932
宿主生物 host_organism	Escherichia coli

▼

7. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (2 domains)

Domain ID domain_id	d2dyfa2
Class class	b — All beta proteins
Fold Fold fold	b.72 — WW domain-like
Superfamily Superfamily superfamily	b.72.1 — WW domain
Family Family family	b.72.1.1 — WW domain

Domain ID domain_id	d2dyfa3
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

▶

8. Citations (1)

▶

Unit-cell length a length_a	1.000 Å
Unit-cell length b length_b	1.000 Å
Unit-cell length c length_c	1.000 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	1

Space group space_group	P 1
Space-group number int_tables_number	1
Crystal system crystal_system	—

fit	/app/data/saxs_computation/dy/2dyf/2dyf.fit
pddf	/app/data/pr_computation/dy/2dyf/2dyf.pr.out
profile	/app/data/saxs_computation/dy/2dyf/2dyf.dat

Solution structure of the first WW domain of FBP11 / HYPA (FBP11 WW1) complexed with a PL (PPLP) motif peptide ligand

1. Protein Identity and Related Structures Protein Identity & Related Structures

Huntingtin-interacting protein HYPA/FBP11

State in the Current Structure

Other States of the Same Protein in the Database

PL (PPLP) motif peptide from Myosin tail region-interacting protein MTI1

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

6. Entities and Polymers Entities & Polymers (2)

Entity 1 Entity 1 polymer

Polymer Polymer

来源 Source

Entity 2 Entity 2 polymer

Polymer Polymer

来源 Source

7. Fold Classification (SCOP + CATH) 2 domains

SCOP 2.08 (2 domains)

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)