2g4m

Insulin collected at 2.0 A wavelength

Method: X-RAY DIFFRACTION D_max: 38.1 Å Quality: GOOD

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Insulin A chain

OrganismNot specified

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein homooligomer Homooligomer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 88–108 Chain B； UniProt 25–54	Not recorded	No other associated polymer	X-RAY DIFFRACTION mmCIF provides none of the parsed experimental conditions	Resolution 1.80 Å R-free 0.223
2	Protein homooligomer Homooligomer Protein × 4 PDB declaration: tetrameric（4） Consistent with protein copy count	Chain A； UniProt 88–108 Chain B； UniProt 25–54	Not recorded	No other associated polymer	X-RAY DIFFRACTION mmCIF provides none of the parsed experimental conditions	Resolution 1.80 Å R-free 0.223

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 2G4M	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1B17 PH AFFECTS GLU B13 SWITCHING AND SULFATE BINDING IN CUBIC INSULIN CRYSTALS (PH 5.00 COORDINATES) Deposited 1998-11-22	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 88–108（21 aa） Chain B 25–54（30 aa）	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 5；pH 5.00	Resolution 1.70 Å R-free 0.219
1B17 PH AFFECTS GLU B13 SWITCHING AND SULFATE BINDING IN CUBIC INSULIN CRYSTALS (PH 5.00 COORDINATES) Deposited 1998-11-22	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 88–108（21 aa） Chain B 25–54（30 aa）	Not recorded	SO4 SULFATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions pH 5；pH 5.00	Resolution 1.70 Å R-free 0.219
1B17 PH AFFECTS GLU B13 SWITCHING AND SULFATE BINDING IN CUBIC INSULIN CRYSTALS (PH 5.00 COORDINATES) Deposited 1998-11-22	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 88–108（21 aa） Chain B 25–54（30 aa）	Not recorded	SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 5；pH 5.00	Resolution 1.70 Å R-free 0.219
1B18 PH AFFECTS GLU B13 SWITCHING AND SULFATE BINDING IN CUBIC INSULIN CRYSTALS (PH 5.53 COORDINATES) Deposited 1998-11-26	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 88–108（21 aa） Chain B 25–54（30 aa）	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.53；pH 5.53	Resolution 1.80 Å R-free 0.216
1B18 PH AFFECTS GLU B13 SWITCHING AND SULFATE BINDING IN CUBIC INSULIN CRYSTALS (PH 5.53 COORDINATES) Deposited 1998-11-26	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 88–108（21 aa） Chain B 25–54（30 aa）	Not recorded	SO4 SULFATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.53；pH 5.53	Resolution 1.80 Å R-free 0.216
1B18 PH AFFECTS GLU B13 SWITCHING AND SULFATE BINDING IN CUBIC INSULIN CRYSTALS (PH 5.53 COORDINATES) Deposited 1998-11-26	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 88–108（21 aa） Chain B 25–54（30 aa）	Not recorded	SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.53；pH 5.53	Resolution 1.80 Å R-free 0.216
1B19 PH AFFECTS GLU B13 SWITCHING AND SULFATE BINDING IN CUBIC INSULIN CRYSTALS (PH 5.80 COORDINATES) Deposited 1998-11-26	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 88–108（21 aa） Chain B 25–54（30 aa）	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.8；pH 5.80	Resolution 1.80 Å R-free 0.231
1B19 PH AFFECTS GLU B13 SWITCHING AND SULFATE BINDING IN CUBIC INSULIN CRYSTALS (PH 5.80 COORDINATES) Deposited 1998-11-26	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 88–108（21 aa） Chain B 25–54（30 aa）	Not recorded	SO4 SULFATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.8；pH 5.80	Resolution 1.80 Å R-free 0.231
1B19 PH AFFECTS GLU B13 SWITCHING AND SULFATE BINDING IN CUBIC INSULIN CRYSTALS (PH 5.80 COORDINATES) Deposited 1998-11-26	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 88–108（21 aa） Chain B 25–54（30 aa）	Not recorded	SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.8；pH 5.80	Resolution 1.80 Å R-free 0.231
1B2A PH AFFECTS GLU B13 SWITCHING AND SULFATE BINDING IN CUBIC INSULIN CRYSTALS (PH 6.00 COORDINATES) Deposited 1998-11-26	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 88–108（21 aa） Chain B 25–54（30 aa）	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6；pH 6.00	Resolution 1.70 Å R-free 0.230
1B2A PH AFFECTS GLU B13 SWITCHING AND SULFATE BINDING IN CUBIC INSULIN CRYSTALS (PH 6.00 COORDINATES) Deposited 1998-11-26	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 88–108（21 aa） Chain B 25–54（30 aa）	Not recorded	SO4 SULFATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions pH 6；pH 6.00	Resolution 1.70 Å R-free 0.230
1B2A PH AFFECTS GLU B13 SWITCHING AND SULFATE BINDING IN CUBIC INSULIN CRYSTALS (PH 6.00 COORDINATES) Deposited 1998-11-26	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 88–108（21 aa） Chain B 25–54（30 aa）	Not recorded	SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 6；pH 6.00	Resolution 1.70 Å R-free 0.230
1B2B PH AFFECTS GLU B13 SWITCHING AND SULFATE BINDING IN CUBIC INSULIN CRYSTALS (PH 6.16 COORDINATES) Deposited 1998-11-26	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 88–108（21 aa） Chain B 25–54（30 aa）	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.16；pH 6.16	Resolution 1.80 Å R-free 0.231
1B2B PH AFFECTS GLU B13 SWITCHING AND SULFATE BINDING IN CUBIC INSULIN CRYSTALS (PH 6.16 COORDINATES) Deposited 1998-11-26	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 88–108（21 aa） Chain B 25–54（30 aa）	Not recorded	SO4 SULFATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.16；pH 6.16	Resolution 1.80 Å R-free 0.231
1B2B PH AFFECTS GLU B13 SWITCHING AND SULFATE BINDING IN CUBIC INSULIN CRYSTALS (PH 6.16 COORDINATES) Deposited 1998-11-26	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 88–108（21 aa） Chain B 25–54（30 aa）	Not recorded	SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.16；pH 6.16	Resolution 1.80 Å R-free 0.231
1B2C PH AFFECTS GLU B13 SWITCHING AND SULFATE BINDING IN CUBIC INSULIN CRYSTALS (PH 6.26 COORDINATES) Deposited 1998-11-26	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 88–108（21 aa） Chain B 25–54（30 aa）	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.26；pH 6.26	Resolution 1.80 Å R-free 0.223
1B2C PH AFFECTS GLU B13 SWITCHING AND SULFATE BINDING IN CUBIC INSULIN CRYSTALS (PH 6.26 COORDINATES) Deposited 1998-11-26	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 88–108（21 aa） Chain B 25–54（30 aa）	Not recorded	SO4 SULFATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.26；pH 6.26	Resolution 1.80 Å R-free 0.223
1B2D PH AFFECTS GLU B13 SWITCHING AND SULFATE BINDING IN CUBIC INSULIN CRYSTALS (PH 6.35 COORDINATES) Deposited 1998-11-26	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 88–108（21 aa） Chain B 25–54（30 aa）	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.35；pH 6.35	Resolution 1.70 Å R-free 0.229
1B2D PH AFFECTS GLU B13 SWITCHING AND SULFATE BINDING IN CUBIC INSULIN CRYSTALS (PH 6.35 COORDINATES) Deposited 1998-11-26	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 88–108（21 aa） Chain B 25–54（30 aa）	Not recorded	SO4 SULFATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.35；pH 6.35	Resolution 1.70 Å R-free 0.229
1B2D PH AFFECTS GLU B13 SWITCHING AND SULFATE BINDING IN CUBIC INSULIN CRYSTALS (PH 6.35 COORDINATES) Deposited 1998-11-26	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 88–108（21 aa） Chain B 25–54（30 aa）	Not recorded	SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.35；pH 6.35	Resolution 1.70 Å R-free 0.229
1B2E PH AFFECTS GLU B13 SWITCHING AND SULFATE BINDING IN CUBIC INSULIN CRYSTALS (PH 6.50 COORDINATES) Deposited 1998-11-26	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 88–108（21 aa） Chain B 25–54（30 aa）	Not recorded	SO4 SULFATE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.5；pH 6.50	Resolution 1.90 Å R-free 0.229
1B2E PH AFFECTS GLU B13 SWITCHING AND SULFATE BINDING IN CUBIC INSULIN CRYSTALS (PH 6.50 COORDINATES) Deposited 1998-11-26	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 88–108（21 aa） Chain B 25–54（30 aa）	Not recorded	SO4 SULFATE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.5；pH 6.50	Resolution 1.90 Å R-free 0.229
1B2E PH AFFECTS GLU B13 SWITCHING AND SULFATE BINDING IN CUBIC INSULIN CRYSTALS (PH 6.50 COORDINATES) Deposited 1998-11-26	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 88–108（21 aa） Chain B 25–54（30 aa）	Not recorded	SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.5；pH 6.50	Resolution 1.90 Å R-free 0.229
1B2F PH AFFECTS GLU B13 SWITCHING AND SULFATE BINDING IN CUBIC INSULIN CRYSTALS (PH 6.98 COORDINATES) Deposited 1998-11-26	Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 88–108（21 aa） Chain B 25–54（30 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.98；pH 6.98	Resolution 1.90 Å R-free 0.244
1B2F PH AFFECTS GLU B13 SWITCHING AND SULFATE BINDING IN CUBIC INSULIN CRYSTALS (PH 6.98 COORDINATES) Deposited 1998-11-26	Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 88–108（21 aa） Chain B 25–54（30 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.98；pH 6.98	Resolution 1.90 Å R-free 0.244
1B2G PH AFFECTS GLU B13 SWITCHING AND SULFATE BINDING IN CUBIC INSULIN CRYSTALS (PH 9.00 COORDINATES) Deposited 1998-11-26	Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 88–108（21 aa） Chain B 25–54（30 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 9；pH 9.00	Resolution 1.80 Å R-free 0.226
1DEI DESHEPTAPEPTIDE (B24-B30) INSULIN Deposited 1996-05-15	Different construct Different mutation/modification Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 88–108（21 aa） Chain B 25–47（23 aa）	Mutation：CHAIN B, DEL(24-30) Mutation：CHAIN B, DEL(24-30)	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.60 Å R-free 0.215
1DEI DESHEPTAPEPTIDE (B24-B30) INSULIN Deposited 1996-05-15	Different construct Different mutation/modification Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 88–108（21 aa） Chain D 25–47（23 aa）	Mutation：CHAIN B, DEL(24-30) Mutation：CHAIN B, DEL(24-30)	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.60 Å R-free 0.215
1DEI DESHEPTAPEPTIDE (B24-B30) INSULIN Deposited 1996-05-15	Different construct Different mutation/modification Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 88–108（21 aa） Chain B 25–47（23 aa） Chain C 88–108（21 aa） Chain D 25–47（23 aa）	Mutation：CHAIN B, DEL(24-30) Mutation：CHAIN B, DEL(24-30) Mutation：CHAIN B, DEL(24-30) Mutation：CHAIN B, DEL(24-30)	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.60 Å R-free 0.215
1IZA ROLE OF B13 GLU IN INSULIN ASSEMBLY: THE HEXAMER STRUCTURE OF RECOMBINANT MUTANT (B13 GLU-> GLN) INSULIN Deposited 1992-10-16	Different construct Different mutation/modification Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 88–108（21 aa） Chain B 25–53（29 aa）	Mutation：E13Q	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.50 Å
1IZA ROLE OF B13 GLU IN INSULIN ASSEMBLY: THE HEXAMER STRUCTURE OF RECOMBINANT MUTANT (B13 GLU-> GLN) INSULIN Deposited 1992-10-16	Different construct Different mutation/modification Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 88–108（21 aa） Chain D 25–53（29 aa）	Mutation：E13Q	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.50 Å
1IZA ROLE OF B13 GLU IN INSULIN ASSEMBLY: THE HEXAMER STRUCTURE OF RECOMBINANT MUTANT (B13 GLU-> GLN) INSULIN Deposited 1992-10-16	Different construct Different mutation/modification Different oligomeric state Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 88–108（21 aa） Chain B 25–53（29 aa） Chain C 88–108（21 aa） Chain D 25–53（29 aa）	Mutation：E13Q Mutation：E13Q	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.50 Å
1IZA ROLE OF B13 GLU IN INSULIN ASSEMBLY: THE HEXAMER STRUCTURE OF RECOMBINANT MUTANT (B13 GLU-> GLN) INSULIN Deposited 1992-10-16	Different construct Different mutation/modification Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 88–108（21 aa） Chain B 25–53（29 aa） Chain C 88–108（21 aa） Chain D 25–53（29 aa）	Mutation：E13Q Mutation：E13Q	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.50 Å
1IZB ROLE OF B13 GLU IN INSULIN ASSEMBLY: THE HEXAMER STRUCTURE OF RECOMBINANT MUTANT (B13 GLU-> GLN) INSULIN Deposited 1992-10-16	Different construct Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 88–108（21 aa） Chain B 25–53（29 aa）	Mutation：E13Q	ZN ZINC ION × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.00 Å
1IZB ROLE OF B13 GLU IN INSULIN ASSEMBLY: THE HEXAMER STRUCTURE OF RECOMBINANT MUTANT (B13 GLU-> GLN) INSULIN Deposited 1992-10-16	Different construct Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 88–108（21 aa） Chain D 25–53（29 aa）	Mutation：E13Q	ZN ZINC ION × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.00 Å
1IZB ROLE OF B13 GLU IN INSULIN ASSEMBLY: THE HEXAMER STRUCTURE OF RECOMBINANT MUTANT (B13 GLU-> GLN) INSULIN Deposited 1992-10-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 88–108（21 aa） Chain B 25–53（29 aa） Chain C 88–108（21 aa） Chain D 25–53（29 aa）	Mutation：E13Q Mutation：E13Q	ZN ZINC ION × 6	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.00 Å
1IZB ROLE OF B13 GLU IN INSULIN ASSEMBLY: THE HEXAMER STRUCTURE OF RECOMBINANT MUTANT (B13 GLU-> GLN) INSULIN Deposited 1992-10-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 88–108（21 aa） Chain B 25–53（29 aa） Chain C 88–108（21 aa） Chain D 25–53（29 aa）	Mutation：E13Q Mutation：E13Q	ZN ZINC ION × 6	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.00 Å
1IZB ROLE OF B13 GLU IN INSULIN ASSEMBLY: THE HEXAMER STRUCTURE OF RECOMBINANT MUTANT (B13 GLU-> GLN) INSULIN Deposited 1992-10-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 88–108（21 aa） Chain B 25–53（29 aa）	Mutation：E13Q	ZN ZINC ION × 3	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.00 Å
1IZB ROLE OF B13 GLU IN INSULIN ASSEMBLY: THE HEXAMER STRUCTURE OF RECOMBINANT MUTANT (B13 GLU-> GLN) INSULIN Deposited 1992-10-16	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 6 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain C 88–108（21 aa） Chain D 25–53（29 aa）	Mutation：E13Q	ZN ZINC ION × 3	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.00 Å
1IZB ROLE OF B13 GLU IN INSULIN ASSEMBLY: THE HEXAMER STRUCTURE OF RECOMBINANT MUTANT (B13 GLU-> GLN) INSULIN Deposited 1992-10-16	Different construct Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 7 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 88–108（21 aa） Chain B 25–53（29 aa） Chain C 88–108（21 aa） Chain D 25–53（29 aa）	Mutation：E13Q Mutation：E13Q	ZN ZINC ION × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.00 Å
1IZB ROLE OF B13 GLU IN INSULIN ASSEMBLY: THE HEXAMER STRUCTURE OF RECOMBINANT MUTANT (B13 GLU-> GLN) INSULIN Deposited 1992-10-16	Different construct Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 8 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 88–108（21 aa） Chain B 25–53（29 aa） Chain C 88–108（21 aa） Chain D 25–53（29 aa）	Mutation：E13Q Mutation：E13Q	ZN ZINC ION × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.00 Å
1M5A Crystal Structure of 2-Co(2+)-Insulin at 1.2A Resolution Deposited 2002-07-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 88–108（21 aa） Chain B 25–54（30 aa） Chain C 88–108（21 aa） Chain D 25–54（30 aa）	Not recorded	CO COBALT (II) ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions SLOW COOLING；pH 6.3；300 K；cobalt acetate, trisodium citrate, acetone, hydrochloric acid, pH 6.3, SLOW COOLING, temperature 300K	Resolution 1.20 Å R-free 0.241
1MPJ X-RAY CRYSTALLOGRAPHIC STUDIES ON HEXAMERIC INSULINS IN THE PRESENCE OF HELIX-STABILIZING AGENTS, THIOCYANATE, METHYLPARABEN AND PHENOL Deposited 1995-09-13	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 88–108（21 aa） Chain B 25–54（30 aa）	Not recorded	IPH PHENOL × 1 ZN ZINC ION × 1 CL CHLORIDE ION × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.30 Å
1MPJ X-RAY CRYSTALLOGRAPHIC STUDIES ON HEXAMERIC INSULINS IN THE PRESENCE OF HELIX-STABILIZING AGENTS, THIOCYANATE, METHYLPARABEN AND PHENOL Deposited 1995-09-13	Different ligand/ion Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 88–108（21 aa） Chain D 25–54（30 aa）	Not recorded	ZN ZINC ION × 1 CL CHLORIDE ION × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.30 Å
1MPJ X-RAY CRYSTALLOGRAPHIC STUDIES ON HEXAMERIC INSULINS IN THE PRESENCE OF HELIX-STABILIZING AGENTS, THIOCYANATE, METHYLPARABEN AND PHENOL Deposited 1995-09-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 88–108（21 aa） Chain B 25–54（30 aa） Chain C 88–108（21 aa） Chain D 25–54（30 aa）	Not recorded	IPH PHENOL × 3 ZN ZINC ION × 6 CL CHLORIDE ION × 6	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.30 Å
1MPJ X-RAY CRYSTALLOGRAPHIC STUDIES ON HEXAMERIC INSULINS IN THE PRESENCE OF HELIX-STABILIZING AGENTS, THIOCYANATE, METHYLPARABEN AND PHENOL Deposited 1995-09-13	Different construct Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 88–108（21 aa） Chain B 25–54（30 aa） Chain C 88–108（21 aa） Chain D 25–54（30 aa）	Not recorded	IPH PHENOL × 1 ZN ZINC ION × 2 CL CHLORIDE ION × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.30 Å
1MPJ X-RAY CRYSTALLOGRAPHIC STUDIES ON HEXAMERIC INSULINS IN THE PRESENCE OF HELIX-STABILIZING AGENTS, THIOCYANATE, METHYLPARABEN AND PHENOL Deposited 1995-09-13	Different construct Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 88–108（21 aa） Chain B 25–54（30 aa） Chain C 88–108（21 aa） Chain D 25–54（30 aa）	Not recorded	IPH PHENOL × 1 ZN ZINC ION × 2 CL CHLORIDE ION × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.30 Å
1MPJ X-RAY CRYSTALLOGRAPHIC STUDIES ON HEXAMERIC INSULINS IN THE PRESENCE OF HELIX-STABILIZING AGENTS, THIOCYANATE, METHYLPARABEN AND PHENOL Deposited 1995-09-13	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 6 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 88–108（21 aa） Chain B 25–54（30 aa）	Not recorded	IPH PHENOL × 3 ZN ZINC ION × 3 CL CHLORIDE ION × 3	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.30 Å
1MPJ X-RAY CRYSTALLOGRAPHIC STUDIES ON HEXAMERIC INSULINS IN THE PRESENCE OF HELIX-STABILIZING AGENTS, THIOCYANATE, METHYLPARABEN AND PHENOL Deposited 1995-09-13	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 7 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain C 88–108（21 aa） Chain D 25–54（30 aa）	Not recorded	ZN ZINC ION × 3 CL CHLORIDE ION × 3	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.30 Å
1SDB PORCINE DESB1-2 DESPENTAPEPTIDE(B26-B30) INSULIN Deposited 1996-01-29	Different construct Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 88–108（21 aa） Chain B 27–49（23 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.65 Å R-free 0.220
1WAV CRYSTAL STRUCTURE OF FORM B MONOCLINIC CRYSTAL OF INSULIN Deposited 1996-02-28	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 88–108（21 aa） Chain B 25–54（30 aa）	Not recorded	IPH PHENOL × 1 ZN ZINC ION × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.50 Å
1WAV CRYSTAL STRUCTURE OF FORM B MONOCLINIC CRYSTAL OF INSULIN Deposited 1996-02-28	Different construct Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 10 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 88–108（21 aa） Chain B 25–54（30 aa） Chain C 88–108（21 aa） Chain D 25–54（30 aa）	Not recorded	IPH PHENOL × 2 ZN ZINC ION × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.50 Å
1WAV CRYSTAL STRUCTURE OF FORM B MONOCLINIC CRYSTAL OF INSULIN Deposited 1996-02-28	Different construct Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 11 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain E 88–108（21 aa） Chain F 25–54（30 aa） Chain G 88–108（21 aa） Chain H 25–54（30 aa）	Not recorded	IPH PHENOL × 3	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.50 Å
1WAV CRYSTAL STRUCTURE OF FORM B MONOCLINIC CRYSTAL OF INSULIN Deposited 1996-02-28	Different construct Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 12 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain I 88–108（21 aa） Chain J 25–54（30 aa） Chain K 88–108（21 aa） Chain L 25–54（30 aa）	Not recorded	IPH PHENOL × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.50 Å
1WAV CRYSTAL STRUCTURE OF FORM B MONOCLINIC CRYSTAL OF INSULIN Deposited 1996-02-28	Different ligand/ion Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 88–108（21 aa） Chain D 25–54（30 aa）	Not recorded	IPH PHENOL × 1 ZN ZINC ION × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.50 Å
1WAV CRYSTAL STRUCTURE OF FORM B MONOCLINIC CRYSTAL OF INSULIN Deposited 1996-02-28	Different ligand/ion Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain E 88–108（21 aa） Chain F 25–54（30 aa）	Not recorded	IPH PHENOL × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.50 Å
1WAV CRYSTAL STRUCTURE OF FORM B MONOCLINIC CRYSTAL OF INSULIN Deposited 1996-02-28	Different ligand/ion Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain G 88–108（21 aa） Chain H 25–54（30 aa）	Not recorded	IPH PHENOL × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.50 Å
1WAV CRYSTAL STRUCTURE OF FORM B MONOCLINIC CRYSTAL OF INSULIN Deposited 1996-02-28	Different ligand/ion Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain I 88–108（21 aa） Chain J 25–54（30 aa）	Not recorded	IPH PHENOL × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.50 Å
1WAV CRYSTAL STRUCTURE OF FORM B MONOCLINIC CRYSTAL OF INSULIN Deposited 1996-02-28	Different structure-quality metrics	Assembly 6 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain K 88–108（21 aa） Chain L 25–54（30 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.50 Å
1WAV CRYSTAL STRUCTURE OF FORM B MONOCLINIC CRYSTAL OF INSULIN Deposited 1996-02-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 7 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 88–108（21 aa） Chain B 25–54（30 aa） Chain C 88–108（21 aa） Chain D 25–54（30 aa） Chain E 88–108（21 aa） Chain F 25–54（30 aa） Chain G 88–108（21 aa） Chain H 25–54（30 aa） Chain I 88–108（21 aa） Chain J 25–54（30 aa） Chain K 88–108（21 aa） Chain L 25–54（30 aa）	Not recorded	IPH PHENOL × 6 ZN ZINC ION × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.50 Å
1WAV CRYSTAL STRUCTURE OF FORM B MONOCLINIC CRYSTAL OF INSULIN Deposited 1996-02-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 8 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 88–108（21 aa） Chain B 25–54（30 aa） Chain E 88–108（21 aa） Chain F 25–54（30 aa） Chain I 88–108（21 aa） Chain J 25–54（30 aa）	Not recorded	IPH PHENOL × 3 ZN ZINC ION × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.50 Å
1WAV CRYSTAL STRUCTURE OF FORM B MONOCLINIC CRYSTAL OF INSULIN Deposited 1996-02-28	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 9 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain C 88–108（21 aa） Chain D 25–54（30 aa） Chain G 88–108（21 aa） Chain H 25–54（30 aa） Chain K 88–108（21 aa） Chain L 25–54（30 aa）	Not recorded	IPH PHENOL × 3 ZN ZINC ION × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.50 Å
1ZEI CROSS-LINKED B28 ASP INSULIN Deposited 1998-07-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 1–51（51 aa） Chain B 1–51（51 aa） Chain C 1–51（51 aa） Chain D 1–51（51 aa） Chain E 1–51（51 aa） Chain F 1–51（51 aa）	Mutation：P28D Mutation：P28D Mutation：P28D Mutation：P28D Mutation：P28D Mutation：P28D	CRS M-CRESOL × 8 ZN ZINC ION × 2 CL CHLORIDE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 6.4；pH 6.4	Resolution 1.90 Å R-free 0.232
1ZNI INSULIN Deposited 1997-09-23	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 88–108（21 aa） Chain B 25–54（30 aa）	Not recorded	ZN ZINC ION × 2 CL CHLORIDE ION × 3	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.50 Å
1ZNI INSULIN Deposited 1997-09-23	Different ligand/ion Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 88–108（21 aa） Chain D 25–54（30 aa）	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.50 Å
1ZNI INSULIN Deposited 1997-09-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 88–108（21 aa） Chain B 25–54（30 aa） Chain C 88–108（21 aa） Chain D 25–54（30 aa）	Not recorded	ZN ZINC ION × 9 CL CHLORIDE ION × 9	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.50 Å
1ZNI INSULIN Deposited 1997-09-23	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 88–108（21 aa） Chain B 25–54（30 aa） Chain C 88–108（21 aa） Chain D 25–54（30 aa）	Not recorded	ZN ZINC ION × 9 CL CHLORIDE ION × 9	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.50 Å
1ZNI INSULIN Deposited 1997-09-23	Different construct Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 88–108（21 aa） Chain B 25–54（30 aa） Chain C 88–108（21 aa） Chain D 25–54（30 aa）	Not recorded	ZN ZINC ION × 3 CL CHLORIDE ION × 3	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.50 Å
1ZNI INSULIN Deposited 1997-09-23	Different construct Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 6 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 88–108（21 aa） Chain B 25–54（30 aa） Chain C 88–108（21 aa） Chain D 25–54（30 aa）	Not recorded	ZN ZINC ION × 3 CL CHLORIDE ION × 3	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.50 Å
1ZNI INSULIN Deposited 1997-09-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 7 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 88–108（21 aa） Chain B 25–54（30 aa）	Not recorded	ZN ZINC ION × 6 CL CHLORIDE ION × 9	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.50 Å
1ZNI INSULIN Deposited 1997-09-23	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 8 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain C 88–108（21 aa） Chain D 25–54（30 aa）	Not recorded	ZN ZINC ION × 3	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.50 Å
2EFA Neutron crystal structure of cubic insulin at pD6.6 Deposited 2007-02-22	Different construct Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 88–108（21 aa） Fragment：Insulin A chain Chain B 25–54（30 aa） Fragment：Insulin B chain	Not recorded	No recorded non-water small molecule	NEUTRON DIFFRACTION X-ray crystallization conditions MICRODIALYSIS；pH 6.6；298 K；0.2M Sodium phosphate, 8mM 3NaEDTA, pH 6.6(PD), MICRODIALYSIS, temperature 298K	Resolution 2.70 Å R-free 0.291
2EFA Neutron crystal structure of cubic insulin at pD6.6 Deposited 2007-02-22	Different construct Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 88–108（21 aa） Fragment：Insulin A chain Chain B 25–54（30 aa） Fragment：Insulin B chain	Not recorded	No recorded non-water small molecule	NEUTRON DIFFRACTION X-ray crystallization conditions MICRODIALYSIS；pH 6.6；298 K；0.2M Sodium phosphate, 8mM 3NaEDTA, pH 6.6(PD), MICRODIALYSIS, temperature 298K	Resolution 2.70 Å R-free 0.291
2TCI X-RAY CRYSTALLOGRAPHIC STUDIES ON HEXAMERIC INSULINS IN THE PRESENCE OF HELIX-STABILIZING AGENTS, THIOCYANATE, METHYLPARABEN AND PHENOL Deposited 1995-09-13	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 88–108（21 aa） Chain B 25–54（30 aa）	Not recorded	SCN THIOCYANATE ION × 1 ZN ZINC ION × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.80 Å
2TCI X-RAY CRYSTALLOGRAPHIC STUDIES ON HEXAMERIC INSULINS IN THE PRESENCE OF HELIX-STABILIZING AGENTS, THIOCYANATE, METHYLPARABEN AND PHENOL Deposited 1995-09-13	Different ligand/ion Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 88–108（21 aa） Chain D 25–54（30 aa）	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.80 Å
2ZPP Neutron crystal structure of cubic insulin at pD9 Deposited 2008-07-26	Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 88–108（21 aa） Chain B 25–54（30 aa）	Not recorded	No recorded non-water small molecule	NEUTRON DIFFRACTION X-ray crystallization conditions MICRODIALYSIS；pH 9；298 K；0.2M sodium phosphate, 10mM 3NaEDTA, pH 9.0, MICRODIALYSIS, temperature 298K	Resolution 2.50 Å R-free 0.260
3FHP A neutron crystallographic analysis of a porcine 2Zn insulin at 2.0 A resolution Deposited 2008-12-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 88–108（21 aa） Fragment：UNP residues 88-108 Chain B 25–54（30 aa） Fragment：UNP residues 25-54 Chain C 88–108（21 aa） Fragment：UNP residues 88-108 Chain D 25–54（30 aa） Fragment：UNP residues 25-54	Not recorded	ZN ZINC ION × 6	NEUTRON DIFFRACTION X-ray crystallization conditions LIQUID DIFFUSION；pH 6.3；293 K；2.3mg/ml insulin, 50mM sodium citrate, 6mM zinc acetate, 17% acetone, pH6.3, LIQUID DIFFUSION, temperature 293K	Resolution 2.00 Å R-free 0.247
3GKY The Structural Basis of an ER Stress-Associated Bottleneck in a Protein Folding Landscape Deposited 2009-03-11	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 88–108（21 aa） Chain B 25–54（30 aa） Chain C 88–108（21 aa） Chain D 25–54（30 aa）	Not recorded	ZN ZINC ION × 6 CL CHLORIDE ION × 6 IPH PHENOL × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 8.1；298 K；0.02 M Tris, 0.05 M sodium citrate, 5% acetone, 0.03% phenol, 0.01% zinc acetate, pH 8.1, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.80 Å R-free 0.253
3INS STRUCTURE OF INSULIN. RESULTS OF JOINT NEUTRON AND X-RAY REFINEMENT Deposited 1988-10-14	Different ligand/ion Different experimental method Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 88–108（21 aa） Chain B 25–54（30 aa）	Not recorded	ZN ZINC ION × 1	Experimental method not declared mmCIF provides none of the parsed conditions	Resolution not provided
3INS STRUCTURE OF INSULIN. RESULTS OF JOINT NEUTRON AND X-RAY REFINEMENT Deposited 1988-10-14	Different ligand/ion Different experimental method Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 88–108（21 aa） Chain D 25–54（30 aa）	Not recorded	ZN ZINC ION × 1	Experimental method not declared mmCIF provides none of the parsed conditions	Resolution not provided
3INS STRUCTURE OF INSULIN. RESULTS OF JOINT NEUTRON AND X-RAY REFINEMENT Deposited 1988-10-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 88–108（21 aa） Chain B 25–54（30 aa） Chain C 88–108（21 aa） Chain D 25–54（30 aa）	Not recorded	ZN ZINC ION × 6	Experimental method not declared mmCIF provides none of the parsed conditions	Resolution not provided
3INS STRUCTURE OF INSULIN. RESULTS OF JOINT NEUTRON AND X-RAY REFINEMENT Deposited 1988-10-14	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 88–108（21 aa） Chain B 25–54（30 aa） Chain C 88–108（21 aa） Chain D 25–54（30 aa）	Not recorded	ZN ZINC ION × 6	Experimental method not declared mmCIF provides none of the parsed conditions	Resolution not provided
3MTH X-RAY CRYSTALLOGRAPHIC STUDIES ON HEXAMERIC INSULINS IN THE PRESENCE OF HELIX-STABILIZING AGENTS, THIOCYANATE, METHYLPARABEN AND PHENOL Deposited 1995-09-13	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 88–108（21 aa） Chain B 25–54（30 aa）	Not recorded	MPB 4-HYDROXY-BENZOIC ACID METHYL ESTER × 1 ZN ZINC ION × 1 CL CHLORIDE ION × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.90 Å
3MTH X-RAY CRYSTALLOGRAPHIC STUDIES ON HEXAMERIC INSULINS IN THE PRESENCE OF HELIX-STABILIZING AGENTS, THIOCYANATE, METHYLPARABEN AND PHENOL Deposited 1995-09-13	Different ligand/ion Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 88–108（21 aa） Chain D 25–54（30 aa）	Not recorded	ZN ZINC ION × 1 CL CHLORIDE ION × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.90 Å
3MTH X-RAY CRYSTALLOGRAPHIC STUDIES ON HEXAMERIC INSULINS IN THE PRESENCE OF HELIX-STABILIZING AGENTS, THIOCYANATE, METHYLPARABEN AND PHENOL Deposited 1995-09-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 88–108（21 aa） Chain B 25–54（30 aa） Chain C 88–108（21 aa） Chain D 25–54（30 aa）	Not recorded	MPB 4-HYDROXY-BENZOIC ACID METHYL ESTER × 3 ZN ZINC ION × 6 CL CHLORIDE ION × 6	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.90 Å
3MTH X-RAY CRYSTALLOGRAPHIC STUDIES ON HEXAMERIC INSULINS IN THE PRESENCE OF HELIX-STABILIZING AGENTS, THIOCYANATE, METHYLPARABEN AND PHENOL Deposited 1995-09-13	Different construct Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 88–108（21 aa） Chain B 25–54（30 aa） Chain C 88–108（21 aa） Chain D 25–54（30 aa）	Not recorded	MPB 4-HYDROXY-BENZOIC ACID METHYL ESTER × 1 ZN ZINC ION × 2 CL CHLORIDE ION × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.90 Å
3MTH X-RAY CRYSTALLOGRAPHIC STUDIES ON HEXAMERIC INSULINS IN THE PRESENCE OF HELIX-STABILIZING AGENTS, THIOCYANATE, METHYLPARABEN AND PHENOL Deposited 1995-09-13	Different construct Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 88–108（21 aa） Chain B 25–54（30 aa） Chain C 88–108（21 aa） Chain D 25–54（30 aa）	Not recorded	MPB 4-HYDROXY-BENZOIC ACID METHYL ESTER × 1 ZN ZINC ION × 2 CL CHLORIDE ION × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.90 Å
3MTH X-RAY CRYSTALLOGRAPHIC STUDIES ON HEXAMERIC INSULINS IN THE PRESENCE OF HELIX-STABILIZING AGENTS, THIOCYANATE, METHYLPARABEN AND PHENOL Deposited 1995-09-13	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 6 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain C 88–108（21 aa） Chain D 25–54（30 aa）	Not recorded	ZN ZINC ION × 3 CL CHLORIDE ION × 3	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.90 Å
3MTH X-RAY CRYSTALLOGRAPHIC STUDIES ON HEXAMERIC INSULINS IN THE PRESENCE OF HELIX-STABILIZING AGENTS, THIOCYANATE, METHYLPARABEN AND PHENOL Deposited 1995-09-13	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 7 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 88–108（21 aa） Chain B 25–54（30 aa）	Not recorded	MPB 4-HYDROXY-BENZOIC ACID METHYL ESTER × 3 ZN ZINC ION × 3 CL CHLORIDE ION × 3	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.90 Å
3RTO Acoustically mounted porcine insulin microcrystals yield an X-ray SAD structure Deposited 2011-05-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 88–108（21 aa） Fragment：Insulin A chain (UNP residues 88-108) Chain B 25–54（30 aa） Fragment：Insulin B chain (UNP residues 25-54) Chain C 88–108（21 aa） Fragment：Insulin A chain (UNP residues 88-108) Chain D 25–54（30 aa） Fragment：Insulin B chain (UNP residues 25-54)	Not recorded	ZN ZINC ION × 6	X-RAY DIFFRACTION X-ray crystallization conditions SMALL TUBES；pH 6；Microcrystals are obtained by dissolving 0.025 g protein in 5 mL of crystallizing solution (200 mL 0.02 M HCl, 100 mL 0.20 M sodium citrate, 60 mL acetone, 20 mL water, 20 mL 0.12 M zinc sulfate) at 315K. The solution is then rapidly quenched to 293K by immersing it in a cool water bath. Quenching speed determines the resulting crystal size. 20-micron crystals are obtained by quenching in a 293K water bath, 10-micron crystals by quenching in a 283K water bath, and 5-micron crystals by quenching in ice water. pH 6.0, SMALL TUBES	Resolution 1.80 Å R-free 0.223
3T2A TMAO-grown cubic insulin (porcine) Deposited 2011-07-22	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 88–108（21 aa） Chain B 25–54（30 aa）	Not recorded	TMO trimethylamine oxide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；298 K；Protein: 10 mg/mL in 50 mM CAPS pH 11; Well: 1.2 M TMAO, 0.1 M malate, pH 5.5 , VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.10 Å R-free 0.223
3T2A TMAO-grown cubic insulin (porcine) Deposited 2011-07-22	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 88–108（21 aa） Chain B 25–54（30 aa）	Not recorded	TMO trimethylamine oxide × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 5.5；298 K；Protein: 10 mg/mL in 50 mM CAPS pH 11; Well: 1.2 M TMAO, 0.1 M malate, pH 5.5 , VAPOR DIFFUSION, SITTING DROP, temperature 298K	Resolution 2.10 Å R-free 0.223
4A7E X-ray crystal structure of porcine insulin flash-cooled at high pressure Deposited 2011-11-14	Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 88–108（21 aa） Chain B 25–54（30 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 10；0.5 M SODIUM PHOSPHATE, 0.01 M EDTA, PH 10.0	Resolution 1.86 Å R-free 0.217
4INS THE STRUCTURE OF 2ZN PIG INSULIN CRYSTALS AT 1.5 ANGSTROMS RESOLUTION Deposited 1989-07-10	Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 88–108（21 aa） Chain B 25–54（30 aa）	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.50 Å
4INS THE STRUCTURE OF 2ZN PIG INSULIN CRYSTALS AT 1.5 ANGSTROMS RESOLUTION Deposited 1989-07-10	Different ligand/ion Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 88–108（21 aa） Chain D 25–54（30 aa）	Not recorded	ZN ZINC ION × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.50 Å
4INS THE STRUCTURE OF 2ZN PIG INSULIN CRYSTALS AT 1.5 ANGSTROMS RESOLUTION Deposited 1989-07-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 12 PDB declaration: dodecameric	Chain A 88–108（21 aa） Chain B 25–54（30 aa） Chain C 88–108（21 aa） Chain D 25–54（30 aa）	Not recorded	ZN ZINC ION × 6	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.50 Å
4INS THE STRUCTURE OF 2ZN PIG INSULIN CRYSTALS AT 1.5 ANGSTROMS RESOLUTION Deposited 1989-07-10	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 4 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain C 88–108（21 aa） Chain D 25–54（30 aa）	Not recorded	ZN ZINC ION × 3	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.50 Å
4INS THE STRUCTURE OF 2ZN PIG INSULIN CRYSTALS AT 1.5 ANGSTROMS RESOLUTION Deposited 1989-07-10	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 5 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain A 88–108（21 aa） Chain B 25–54（30 aa）	Not recorded	ZN ZINC ION × 3	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.50 Å
4INS THE STRUCTURE OF 2ZN PIG INSULIN CRYSTALS AT 1.5 ANGSTROMS RESOLUTION Deposited 1989-07-10	Different construct Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 6 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 88–108（21 aa） Chain B 25–54（30 aa） Chain C 88–108（21 aa） Chain D 25–54（30 aa）	Not recorded	ZN ZINC ION × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.50 Å
4INS THE STRUCTURE OF 2ZN PIG INSULIN CRYSTALS AT 1.5 ANGSTROMS RESOLUTION Deposited 1989-07-10	Different construct Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 7 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 88–108（21 aa） Chain B 25–54（30 aa） Chain C 88–108（21 aa） Chain D 25–54（30 aa）	Not recorded	ZN ZINC ION × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.50 Å
5D52 In meso in situ serial X-ray crystallography structure of insulin at room temperature Deposited 2015-08-10	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 88–108（21 aa） Chain B 25–54（30 aa）	Not recorded	PO4 PHOSPHATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions LIPIDIC CUBIC PHASE；293 K；0.1-0.2 M sodium phosphate, pH 5.5-6.1, and 33-38 %(w/v) PEG400	Resolution 1.80 Å R-free 0.214
5D53 In meso in situ serial X-ray crystallography structure of insulin at 100 K Deposited 2015-08-10	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 88–108（21 aa） Chain B 25–54（30 aa）	Not recorded	PO4 PHOSPHATE ION × 2 PE5 3,6,9,12,15,18,21,24-OCTAOXAHEXACOSAN-1-OL × 1	X-RAY DIFFRACTION X-ray crystallization conditions LIPIDIC CUBIC PHASE；293 K；0.1-0.2 M sodium phosphate, pH 5.5-6.1, and 33-38 %(w/v) PEG400	Resolution 1.50 Å R-free 0.170
5D54 In meso X-ray crystallography structure of insulin at 100 K Deposited 2015-08-10	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 88–108（21 aa） Chain B 25–54（30 aa）	Not recorded	PO4 PHOSPHATE ION × 2 PE5 3,6,9,12,15,18,21,24-OCTAOXAHEXACOSAN-1-OL × 1	X-RAY DIFFRACTION X-ray crystallization conditions LIPIDIC CUBIC PHASE；293 K；0.1-0.2 M sodium phosphate, pH 5.5-6.1, and 33-38 %(w/v) PEG400	Resolution 1.50 Å R-free 0.188
5D5E In meso in situ serial X-ray crystallography structure of insulin by sulfur-SAD at 100 K Deposited 2015-08-10	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 88–108（21 aa） Chain B 25–54（30 aa）	Not recorded	PO4 PHOSPHATE ION × 2 PE5 3,6,9,12,15,18,21,24-OCTAOXAHEXACOSAN-1-OL × 1	X-RAY DIFFRACTION X-ray crystallization conditions LIPIDIC CUBIC PHASE；293 K；0.1-0.2 M sodium phosphate, pH 5.5-6.1, and 33-38 %(w/v) PEG400	Resolution 2.41 Å R-free 0.220
5FB6 Room-temperature macromolecular crystallography using a micro-patterned silicon chip with minimal background scattering Deposited 2015-12-14	Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 88–108（21 aa） Chain B 25–54（30 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；0.6 M Na2HPO4 0.01 M EDTA	Resolution 1.90 Å R-free 0.173
5LIS Insulin solved by Native SAD from a dataset collected in one second Deposited 2016-07-15	Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 88–108（21 aa） Chain B 25–54（30 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；298 K；30% ethylene glycol	Resolution 2.29 Å R-free 0.262
6INS X-RAY ANALYSIS OF THE SINGLE CHAIN B29-A1 PEPTIDE-LINKED INSULIN MOLECULE. A COMPLETELY INACTIVE ANALOGUE Deposited 1992-11-25	Different construct Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain E 25–53（29 aa） Chain E 88–108（21 aa） Chain F 25–53（29 aa） Chain F 88–108（21 aa）	Not recorded	ZN ZINC ION × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.00 Å
6INS X-RAY ANALYSIS OF THE SINGLE CHAIN B29-A1 PEPTIDE-LINKED INSULIN MOLECULE. A COMPLETELY INACTIVE ANALOGUE Deposited 1992-11-25	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 6 PDB declaration: hexameric	Chain E 25–53（29 aa） Chain E 88–108（21 aa） Chain F 25–53（29 aa） Chain F 88–108（21 aa）	Not recorded	ZN ZINC ION × 6	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.00 Å
6Z7Z Porcine insulin in complex with the analytical antibody OXI-005 Fab Deposited 2020-06-02	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain G 88–108（21 aa） Chain H 25–54（30 aa）	Not recorded	MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.2 M magnesium chloride, 20 % (w/v) PEG 3350	Resolution 2.40 Å R-free 0.259
6Z7Z Porcine insulin in complex with the analytical antibody OXI-005 Fab Deposited 2020-06-02	Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain E 88–108（21 aa） Chain F 25–54（30 aa）	Not recorded	MG MAGNESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；0.2 M magnesium chloride, 20 % (w/v) PEG 3350	Resolution 2.40 Å R-free 0.259
7AC4 Structure of insulin collected by rotation serial crystallography on a COC membrane at a synchrotron source Deposited 2020-09-09	Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 88–108（21 aa） Chain B 25–54（30 aa）	Not recorded	PGR R-1,2-PROPANEDIOL × 1 NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；293 K；50mM Na2HPO4, 10mM EDTA pH 10.8	Resolution 1.46 Å R-free 0.180
7INS STRUCTURE OF PORCINE INSULIN COCRYSTALLIZED WITH CLUPEINE Z Deposited 1991-09-03	Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain A 88–108（21 aa） Chain B 25–54（30 aa）	Not recorded	CRS M-CRESOL × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.00 Å
7INS STRUCTURE OF PORCINE INSULIN COCRYSTALLIZED WITH CLUPEINE Z Deposited 1991-09-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 10 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain B 25–54（30 aa） Chain D 25–54（30 aa） Chain F 25–54（30 aa）	Not recorded	ZN ZINC ION × 1 UNL UNKNOWN LIGAND × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.00 Å
7INS STRUCTURE OF PORCINE INSULIN COCRYSTALLIZED WITH CLUPEINE Z Deposited 1991-09-03	Different ligand/ion Different structure-quality metrics	Assembly 11 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain C 88–108（21 aa） Chain D 25–54（30 aa）	Not recorded	CRS M-CRESOL × 2 ZN ZINC ION × 2 UNL UNKNOWN LIGAND × 4	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.00 Å
7INS STRUCTURE OF PORCINE INSULIN COCRYSTALLIZED WITH CLUPEINE Z Deposited 1991-09-03	Different ligand/ion Different structure-quality metrics	Assembly 12 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 88–108（21 aa） Chain B 25–54（30 aa）	Not recorded	CRS M-CRESOL × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.00 Å
7INS STRUCTURE OF PORCINE INSULIN COCRYSTALLIZED WITH CLUPEINE Z Deposited 1991-09-03	Different ligand/ion Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain C 88–108（21 aa） Chain D 25–54（30 aa）	Not recorded	CRS M-CRESOL × 1 ZN ZINC ION × 1 UNL UNKNOWN LIGAND × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.00 Å
7INS STRUCTURE OF PORCINE INSULIN COCRYSTALLIZED WITH CLUPEINE Z Deposited 1991-09-03	Different ligand/ion Different structure-quality metrics	Assembly 3 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain E 88–108（21 aa） Chain F 25–54（30 aa）	Not recorded	CRS M-CRESOL × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.00 Å
7INS STRUCTURE OF PORCINE INSULIN COCRYSTALLIZED WITH CLUPEINE Z Deposited 1991-09-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 14 PDB declaration: tetradecameric	Chain A 88–108（21 aa） Chain B 25–54（30 aa） Chain C 88–108（21 aa） Chain D 25–54（30 aa） Chain E 88–108（21 aa） Chain F 25–54（30 aa）	Not recorded	CRS M-CRESOL × 6 ZN ZINC ION × 2 UNL UNKNOWN LIGAND × 4	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.00 Å
7INS STRUCTURE OF PORCINE INSULIN COCRYSTALLIZED WITH CLUPEINE Z Deposited 1991-09-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 5 Protein heterocomplex Heteromer；Protein × 7 PDB declaration: heptameric	Chain A 88–108（21 aa） Chain B 25–54（30 aa） Chain C 88–108（21 aa） Chain D 25–54（30 aa） Chain E 88–108（21 aa） Chain F 25–54（30 aa）	Not recorded	CRS M-CRESOL × 3 ZN ZINC ION × 1 UNL UNKNOWN LIGAND × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.00 Å
7INS STRUCTURE OF PORCINE INSULIN COCRYSTALLIZED WITH CLUPEINE Z Deposited 1991-09-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 6 Protein heterocomplex Heteromer；Protein × 10 PDB declaration: decameric	Chain C 88–108（21 aa） Chain D 25–54（30 aa） Chain E 88–108（21 aa） Chain F 25–54（30 aa）	Not recorded	CRS M-CRESOL × 4 ZN ZINC ION × 2 UNL UNKNOWN LIGAND × 4	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.00 Å
7INS STRUCTURE OF PORCINE INSULIN COCRYSTALLIZED WITH CLUPEINE Z Deposited 1991-09-03	Different ligand/ion Different structure-quality metrics	Assembly 7 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 88–108（21 aa） Chain B 25–54（30 aa）	Not recorded	CRS M-CRESOL × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.00 Å
7INS STRUCTURE OF PORCINE INSULIN COCRYSTALLIZED WITH CLUPEINE Z Deposited 1991-09-03	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different structure-quality metrics	Assembly 8 Protein heterocomplex Heteromer；Protein × 8 PDB declaration: octameric	Chain B 25–54（30 aa） Chain D 25–54（30 aa） Chain F 25–54（30 aa）	Not recorded	ZN ZINC ION × 2 UNL UNKNOWN LIGAND × 4	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.00 Å
7INS STRUCTURE OF PORCINE INSULIN COCRYSTALLIZED WITH CLUPEINE Z Deposited 1991-09-03	Different construct Different mutation/modification Different ligand/ion Different structure-quality metrics	Assembly 9 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain C 88–108（21 aa） Chain D 25–54（30 aa） Chain E 88–108（21 aa） Chain F 25–54（30 aa）	Not recorded	CRS M-CRESOL × 2 ZN ZINC ION × 1 UNL UNKNOWN LIGAND × 2	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.00 Å
9INS MONOVALENT CATION BINDING IN CUBIC INSULIN CRYSTALS Deposited 1991-10-23	Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 88–108（21 aa） Chain B 25–54（30 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.70 Å
9INS MONOVALENT CATION BINDING IN CUBIC INSULIN CRYSTALS Deposited 1991-10-23	Different structure-quality metrics	Assembly 2 Protein homooligomer Homooligomer；Protein × 4 PDB declaration: tetrameric	Chain A 88–108（21 aa） Chain B 25–54（30 aa）	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.70 Å

41 other PDB entries and 125 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	INS_PIG
Isoform	—
PDB entities	1, 2
Chains and sequence ranges	Author chain A； PDBConstruct 1–21； UniProt 88–108 Author chain B； PDBConstruct 1–30； UniProt 25–54

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2g4m
Deposition date deposition_date	2006-02-22
Structure title title	Insulin collected at 2.0 A wavelength
Keywords keywords	insulin at 2.0 A wavelength, HORMONE-GROWTH FACTOR COMPLEX; HORMONE/GROWTH FACTOR
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	11.24 Å
Radius of gyration Rg (electron density) rg_electron	9.89 Å
Forward intensity I(0) i0	817514.00
Molecular weight molecular_weight	5782.0 kDa
Excluded volume excluded_volume	7173 Å³
Envelope volume envelope_volume	7647 Å³
Hydration-shell volume shell_volume	6908 Å³
Envelope diameter envelope_diameter	35.3 Å
Shell Rg shell_rg	14.99 Å
Envelope Rg envelope_rg	10.25 Å
Shape Rg shape_rg	9.90 Å
Total Rg total_rg	11.31 Å
Total atoms total_atoms	403
Residues n_residues	51
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	38.1 Å
Rg (real space) rg_real	11.19 Å
Rg uncertainty (real space) rg_real_error	0.38 Å
I(0) (real space) i0_real	8.1750e+05
I(0) uncertainty (real space) i0_real_error	8.3700e+03
Rg (reciprocal space) rg_reciprocal	11.19 Å
I(0) (reciprocal space) i0_reciprocal	817500.0000
Solution quality estimate total_estimate	0.8708
Solution quality rating solution_quality	GOOD a GOOD solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	14.5 Å
Skewness Skewness skewness	0.175
Kurtosis Kurtosis kurtosis	-0.222
Angular range angular_range	— – 0.5000 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	85300.0000
Real-space data points n_real_points	80
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.783; Stabil: 1.000; Sysdev: 1.000; Positv: 1.000; Valcen: 0.997; Smooth: 0.969

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	Insulin A chain
Molecular weight formula_weight	2383.7 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	472

GIVEQCCTSICSLYQLENYCN

Entity 2 Entity 2 polymer

Description description	Insulin B chain
Molecular weight formula_weight	3403.9 kDa
Source method src_method	nat
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	B

FVNQHLCGSHLVEALYLVCGERGFFYTPKA

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	61

▶

8. Citations (1)

▶

Unit-cell length a length_a	78.270 Å
Unit-cell length b length_b	78.270 Å
Unit-cell length c length_c	78.270 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	24

Space group space_group	I 21 3
Space-group number int_tables_number	199
Crystal system crystal_system	—

Resolution resolution	1.800 Å
Low-resolution limit resolution_low	30.000 Å
R factor r_factor	0.1677
R_work r_work	0.1665
R_free r_free	0.2230

fit	/app/data/saxs_computation/g4/2g4m/2g4m.fit
pddf	/app/data/pr_computation/g4/2g4m/2g4m.pr.out
profile	/app/data/saxs_computation/g4/2g4m/2g4m.dat

Insulin collected at 2.0 A wavelength

1. Protein Identity and Related Structures Protein Identity & Related Structures

Insulin A chain

State in the Current Structure

Other States of the Same Protein in the Database

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

2. Structure Basics 2. Structure Basics

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

5. Crystallography and Experiment 5. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 water

8. Citations (1)

9. Files and Curves (10)

Files (7)

Curves (3)