2hft

THE CRYSTAL STRUCTURE OF THE EXTRACELLULAR DOMAIN OF HUMAN TISSUE FACTOR AT 1.7 ANGSTROMS RESOLUTION

Method: X-RAY DIFFRACTION D_max: 88.0 Å Quality: REASONABLE

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

HUMAN TISSUE FACTOR

Homo sapiens

State in the Current Structure

Assembly	Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Associated Components	Method and Experimental Conditions	Structure Quality
1	Protein homooligomer Homooligomer Protein × 2 PDB declaration: dimeric（2） Consistent with protein copy count	Chain A； UniProt 33–243	Not recorded	SO4 SULFATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions：pH 7.5；pH 7.5	Resolution 1.69 Å R-free 0.254

Other States of the Same Protein in the Database

Each row is a biological assembly of the same UniProt protein in another PDB entry. The “Difference from current entry” column identifies evidence-level differences; no tag means the currently parsed fields agree.

Other PDB	Difference from Current Entry 2HFT	Assembly / Oligomeric State	Construct	Mutations and Modifications	Ligands, Ions and Non-polymers	Method and Experimental Conditions	Structure Quality
1AHW A COMPLEX OF EXTRACELLULAR DOMAIN OF TISSUE FACTOR WITH AN INHIBITORY FAB (5G9) Deposited 1997-04-10	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 6 PDB declaration: hexameric	Chain C 33–251（219 aa） Fragment：EXTRACELLULAR DOMAIN Chain F 33–251（219 aa） Fragment：EXTRACELLULAR DOMAIN	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 7；TF-5G9 CRYSTAL WERE GROWN IN 1.7-2.0M AMMONIUM SULFATE, 0.1M SODIUM CITRATE, PH 5.0-5.5, 0.2% 2-METHYL-2,4-PENTANE-DIOL (MPD), AND 2% PEG 600 AT AN EQUIMOLAR 5G9:TF RATIO. THE CRYSTALS GREW EXTREMELY SLOWLY, TAKING 6-9 MONTHS TO REACH A MAXIMAL SIZE OF 0.4 X 0.4 X 0.8 MM3., pH 7.0	Resolution 3.00 Å R-free 0.285
1BOY EXTRACELLULAR REGION OF HUMAN TISSUE FACTOR Deposited 1996-01-11	Different construct Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein homooligomer Homooligomer；Protein × 2 PDB declaration: dimeric	Chain A 33–251（219 aa） Fragment：EXTRACELLULAR DOMAIN, RESIDUES 1 - 219	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.20 Å
1DAN Complex of active site inhibited human blood coagulation factor VIIA with human recombinant soluble tissue factor Deposited 1997-03-05	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain T 37–116（80 aa） Chain U 122–242（121 aa）	Not recorded	BGC beta-D-glucopyranose × 1 FUC alpha-L-fucopyranose × 1 CA CALCIUM ION × 9 0Z6 D-phenylalanyl-N-[(2S,3S)-6-{[amino(iminio)methyl]amino}-1-chloro-2-hydroxyhexan-3-yl]-L-phenylalaninamide × 1 CAC CACODYLATE ION × 1 CL CHLORIDE ION × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 2.00 Å R-free 0.218
1FAK HUMAN TISSUE FACTOR COMPLEXED WITH COAGULATION FACTOR VIIA INHIBITED WITH A BPTI-MUTANT Deposited 1998-12-28	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain T 37–242（206 aa）	Not recorded	GLC alpha-D-glucopyranose × 1 FUC alpha-L-fucopyranose × 1 CA CALCIUM ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.6；pH 5.6	Resolution 2.10 Å
1J9C Crystal Structure of tissue factor-factor VIIa complex Deposited 2001-05-24	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain T 33–242（210 aa）	Not recorded	GLC alpha-D-glucopyranose × 1 FUL beta-L-fucopyranose × 1 0Z6 D-phenylalanyl-N-[(2S,3S)-6-{[amino(iminio)methyl]amino}-1-chloro-2-hydroxyhexan-3-yl]-L-phenylalaninamide × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.5；295 K；2% PEG 400, 2% 2-propanol, 2% PEG 4000, 12.5mM Calcium chloride, 2.0M ammonium sulfate, 0.1M HEPES, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 295K	Resolution 2.90 Å R-free 0.299
1JPS Crystal structure of tissue factor in complex with humanized Fab D3h44 Deposited 2001-08-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain T 33–251（219 aa） Fragment：extracellular domain	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；277 K；PEG 6000, sodium chloride, sodium-HEPES buffer, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 1.85 Å R-free 0.224
1O5D Dissecting and Designing Inhibitor Selectivity Determinants at the S1 site Using an Artificial Ala190 Protease (Ala190 uPA) Deposited 2003-09-09	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain T 34–251（218 aa）	Mutation：residues 2-219	CR9 2-{5-[AMINO(IMINIO)METHYL]-6-FLUORO-1H-BENZIMIDAZOL-2-YL}-6-[(2-METHYLCYCLOHEXYL)OXY]BENZENOLATE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.2；290 K；0.1 M citrate, 16-18% PEG 5K MME, pH 7.2, vapor diffusion at 290 K	Resolution 2.05 Å R-free 0.262
1TFH EXTRACELLULAR DOMAIN OF HUMAN TISSUE FACTOR Deposited 1997-04-10	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 33–251（219 aa） Fragment：EXTRACELLULAR DOMAIN	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 7；278 K；CRYSTAL CAN BE GROWN FROM 20MM PHOSPHATE BUFFER, PH 6.5, AT A 40MG/ML PROTEIN CONCENTRATION. THE CRYSTALS USED FOR DIFFRACTION STUDIES WERE IN FACT CRYSTALLIZED UNEXPECTEDLY IN 2 DAYS IN AN NMR TUBE CONTAINING A SOLUTION OF APPROXIMATELY 3.5MM OF UNIFORMLY 15N-ENRICHED (~99 ATOM%) TISSUE FACTOR (AT ~85 MG/ML) IN 20MM KNA2PO4, 0.02%NAN3, 10% D2O AND 90% H2O, PH 7.0 AT 5 DEGREE., temperature 278K	Resolution 2.40 Å R-free 0.297
1TFH EXTRACELLULAR DOMAIN OF HUMAN TISSUE FACTOR Deposited 1997-04-10	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain B 33–251（219 aa） Fragment：EXTRACELLULAR DOMAIN	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions pH 7；278 K；CRYSTAL CAN BE GROWN FROM 20MM PHOSPHATE BUFFER, PH 6.5, AT A 40MG/ML PROTEIN CONCENTRATION. THE CRYSTALS USED FOR DIFFRACTION STUDIES WERE IN FACT CRYSTALLIZED UNEXPECTEDLY IN 2 DAYS IN AN NMR TUBE CONTAINING A SOLUTION OF APPROXIMATELY 3.5MM OF UNIFORMLY 15N-ENRICHED (~99 ATOM%) TISSUE FACTOR (AT ~85 MG/ML) IN 20MM KNA2PO4, 0.02%NAN3, 10% D2O AND 90% H2O, PH 7.0 AT 5 DEGREE., temperature 278K	Resolution 2.40 Å R-free 0.297
1UJ3 Crystal structure of a humanized Fab fragment of anti-tissue-factor antibody in complex with tissue factor Deposited 2003-07-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 38–242（205 aa） Fragment：RESIDUES 606-810	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；277 K；2-propanol, PEG4000, HEPES-Na, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 277K	Resolution 2.10 Å R-free 0.227
1W0Y tf7a_3771 complex Deposited 2004-05-27	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain T 33–242（210 aa） Fragment：EXTRACELLULAR DOMAIN, RESIDUES 38-242	Not recorded	771 4-(4-BENZYLOXY-2-METHANESULFONYLAMINO-5-METHOXY-BENZYLAMINO)-BENZAMIDINE × 1 CA CALCIUM ION × 9 CAC CACODYLATE ION × 1 FUC alpha-L-fucopyranose × 1 BGC beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.5；pH 5.50	Resolution 2.50 Å R-free 0.258
1W2K tf7a_4380 complex Deposited 2004-07-06	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain T 33–242（210 aa） Fragment：EXTRACELLULAR DOMAIN, RESIDUES 38-242	Not recorded	380 (2R)-2-({4-[AMINO(IMINO)METHYL]PHENYL}AMINO)-N-BENZYL-2-(3,4-DIMETHOXYPHENYL)ACETAMIDE × 1 CA CALCIUM ION × 9 CAC CACODYLATE ION × 1 FUC alpha-L-fucopyranose × 1 BGC beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 5.5；pH 5.50	Resolution 3.00 Å R-free 0.257
1WQV Human Factor Viia-Tissue Factor Complexed with propylsulfonamide-D-Thr-Met-p-aminobenzamidine Deposited 2004-10-02	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain T 33–250（218 aa） Fragment：residues 1-218	Not recorded	BGC beta-D-glucopyranose × 1 FUC alpha-L-fucopyranose × 1 CA CALCIUM ION × 9 PSM N-[DIHYDROXY(PROPYL)-LAMBDA~4~-SULFANYL]THREONYL-N~1~-{4-[AMINO(IMINO)METHYL]BENZYL}METHIONINAMIDE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5；298 K；PEG 5000, sodium chloride, cacodylate, calcium chloride, pH 5.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.50 Å R-free 0.272
1WSS Human Factor Viia-Tissue Factor in Complex with peptide-mimetic inhibitor that has two charged groups in P2 and P4 Deposited 2004-11-10	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain T 33–250（218 aa） Fragment：RESIDUES 1-218	Not recorded	BGC beta-D-glucopyranose × 1 FUC alpha-L-fucopyranose × 1 CA CALCIUM ION × 9 3CB N-[(3-CARBOXYBENZYL)SULFONYL]ISOLEUCYL-N~1~-{4-[AMINO(IMINO)METHYL]BENZYL}-5-IMINOORNITHINAMIDE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5；298 K；PEG 5000, sodium chloride, cacodylate, calcium chloride, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.60 Å R-free 0.282
1WTG Human Factor Viia-Tissue Factor Complexed with ethylsulfonamide-D-biphenylalanine-Gln-p-aminobenzamidine Deposited 2004-11-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain T 33–250（218 aa） Fragment：RESIDUES 1-218	Not recorded	BGC beta-D-glucopyranose × 1 FUC alpha-L-fucopyranose × 1 CA CALCIUM ION × 9 3BP 2-(3-BIPHENYL-4-YL-2-ETHANESULFONYLAMINO-PROPIONYLAMINO)-PENTANEDIOIC ACID 5-AMIDE 1-(4-CARBAMIMIDOYL-BENZYLAMIDE) × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5；298 K；PEG 5000, sodium chloride, cacodylate, calcium chloride, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.20 Å R-free 0.251
1WUN Human Factor Viia-Tissue Factor Complexed with ethylsulfonamide-D-Trp-Gln-p-aminobenzamidine Deposited 2004-12-08	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain T 33–250（218 aa） Fragment：RESIDUES 1-218	Not recorded	BGC beta-D-glucopyranose × 1 FUC alpha-L-fucopyranose × 1 CA CALCIUM ION × 9 P5B N-(ETHYLSULFONYL)TRYPTOPHYL-N~1~-{4-[AMINO(IMINO)METHYL]BENZYL}GLUTAMAMIDE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5；298 K；PEG 5000, sodium chloride, cacodylate, calcium chloride, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.40 Å R-free 0.264
1WV7 Human Factor Viia-Tissue Factor Complexed with ethylsulfonamide-D-5-propoxy-Trp-Gln-p-aminobenzamidine Deposited 2004-12-11	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain T 33–250（218 aa） Fragment：RESIDUES 1-218	Not recorded	BGC beta-D-glucopyranose × 1 FUC alpha-L-fucopyranose × 1 CA CALCIUM ION × 9 5PI N-(ETHYLSULFONYL)-5-PROPOXY-L-TRYPTOPHYL-N~1~-{4-[AMINO(IMINO)METHYL]BENZYL}-L-GLUTAMAMIDE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5；298 K；PEG 5000, sodium chloride, cacodylate, calcium chloride, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.70 Å R-free 0.273
1Z6J Crystal Structure of a ternary complex of Factor VIIa/Tissue Factor/Pyrazinone Inhibitor Deposited 2005-03-22	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain T 33–243（211 aa） Fragment：Residues 33-243	Not recorded	CA CALCIUM ION × 2 MG MAGNESIUM ION × 1 PY3 5-[AMINO(IMINO)METHYL]-2-[({[6-[3-AMINO-5-({[(1R)-1-METHYLPROPYL]AMINO}CARBONYL)PHENYL]-3-(ISOPROPYLAMINO)-2-OXOPYRAZIN-1(2H)-YL]ACETYL}AMINO)METHYL]-N-PYRIDIN-4-YLBENZAMIDE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION；pH 7.5；298 K；50 mM citrate, 16-24% PEG 4K, 150 mM MgCl2, pH 7.5, VAPOR DIFFUSION, temperature 298K	Resolution 2.00 Å R-free 0.258
2A2Q Complex of Active-site Inhibited Human Coagulation Factor VIIa with Human Soluble Tissue Factor in the Presence of Ca2+, Mg2+, Na+, and Zn2+ Deposited 2005-06-22	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain T 38–242（205 aa） Fragment：residues 38-242	Not recorded	GLC alpha-D-glucopyranose × 1 FUC alpha-L-fucopyranose × 1 MG MAGNESIUM ION × 3 CA CALCIUM ION × 6 NA SODIUM ION × 1 ZN ZINC ION × 2 CL CHLORIDE ION × 3 PBZ P-AMINO BENZAMIDINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7；298 K；PEG 4000, magnesium chloride, sodium chloride, calcium chloride, zinc chloride, Tris-HCl, VAPOR DIFFUSION, SITTING DROP, temperature 298K, pH 7.00	Resolution 1.80 Å R-free 0.259
2AEI Crystal structure of a ternary complex of factor VIIa/tissue factor and 2-[[6-[3-(aminoiminomethyl)phenoxy]-3,5-difluro-4-[(1-methyl-3-phenylpropyl)amino]-2-pyridinyl]oxy]-benzoic acid Deposited 2005-07-22	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain T 33–243（211 aa） Fragment：RESIDUES 33-243	Not recorded	CA CALCIUM ION × 8 CAC CACODYLATE ION × 1 03R 2-({6-{3-[AMINO(IMINO)METHYL]PHENOXY}-3,5-DIFLUORO-4-[(1-METHYL-3-PHENYLPROPYL)AMINO]-2-PYRIDINYL}OXY)BENZOIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5；298 K；PEG 8000,CACODYLATE, GLYCEROL, pH 5.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.52 Å R-free 0.297
2AER Crystal Structure of Benzamidine-Factor VIIa/Soluble Tissue Factor complex. Deposited 2005-07-23	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain T 38–242（205 aa）	Not recorded	GLC alpha-D-glucopyranose × 1 FUC alpha-L-fucopyranose × 1 MG MAGNESIUM ION × 3 CA CALCIUM ION × 6 NA SODIUM ION × 1 ZN ZINC ION × 2 CL CHLORIDE ION × 3 BEN BENZAMIDINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.2；298 K；Tris, Sodium Chloride, Calcium Chloride, PEG 4000, ADA, Magnesium Chloride, pH 6.2, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.87 Å R-free 0.256
2B7D Factor VIIa Inhibitors: Chemical Optimization, Preclinical Pharmacokinetics, Pharmacodynamics, and Efficacy in a Baboon Thrombosis Model Deposited 2005-10-04	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain T 34–251（218 aa）	Not recorded	C1B (2R)-2-[5-(5-CARBAMIMIDOYL-1H-BENZOIMIDAZOL-2-YL)-6,2'-DIHYDROXY-5'-UREIDOMETHYL-BIPHENYL-3-YL]-SUCCINIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.2；290 K；0.1 M citrate, 16-18 % PEG 5K MME, pH 7.2, VAPOR DIFFUSION, HANGING DROP, temperature 290.0K	Resolution 2.24 Å R-free 0.289
2B8O Crystal Structure of Glu-Gly-Arg-Chloromethyl Ketone-Factor VIIa/Soluble Tissue Factor Complex Deposited 2005-10-08	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain T 38–242（205 aa）	Not recorded	GLC alpha-D-glucopyranose × 1 FUC alpha-L-fucopyranose × 1 CA CALCIUM ION × 6 MG MAGNESIUM ION × 2 0GJ L-alpha-glutamyl-N-{(1S)-4-{[amino(iminio)methyl]amino}-1-[(1S)-2-chloro-1-hydroxyethyl]butyl}glycinamide × 1 NA SODIUM ION × 1 ZN ZINC ION × 2 CL CHLORIDE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.2；298 K；Tris, sodium chloride, calcium chloride, PEG 4000, ADA, magnesium chloride, pH 6.2, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.80 Å R-free 0.285
2C4F crystal structure of factor VII.stf complexed with pd0297121 Deposited 2005-10-18	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain T 38–112（75 aa） Fragment：FACTOR III, RESIDUES 38-112 Chain U 123–242（120 aa） Fragment：FACTOR III, RESIDUES 123-242	Not recorded	CA CALCIUM ION × 5 GIL 2-{[6-{3-[AMINO(IMINO)METHYL]PHENOXY}-4-(DIISOPROPYLAMINO)-3,5-DIFLUOROPYRIDIN-2-YL]OXY}-5-[(ISOBUTYLAMINO)CARBONYL]BEN ZOIC ACID × 1 GLC alpha-D-glucopyranose × 1 FUC alpha-L-fucopyranose × 1 NAG 2-acetamido-2-deoxy-beta-D-glucopyranose × 1	X-RAY DIFFRACTION mmCIF provides none of the parsed conditions	Resolution 1.72 Å
2CEF Phosphorylation of the Cytoplasmic Tail of Tissue Factor and its Role in Modulating Structure and Binding Affinity. Deposited 2006-02-06	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 277–295（19 aa） Fragment：TISSUE FACTOR CYTOPLASMIC DOMAIN, RESIDUES 277-295	Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6；285 K；Ionic strength (raw mmCIF value) 0 NMR sample composition 90% WATER 10% D2O	Resolution not provided
2CEH Phosphorylation of the Cytoplasmic Tail of Tissue Factor and its Role in Modulating Structure and Binding Affinity Deposited 2006-02-06	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 277–295（19 aa） Fragment：TISSUE FACTOR CYTOPLASMIC DOMAIN, RESIDUES 277-295	Not recorded	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6；285 K；Ionic strength (raw mmCIF value) 0；Pressure 1.0 NMR measurement conditions pH 6；285 K；Ionic strength (raw mmCIF value) 0；Pressure 1.0 NMR sample composition 90% WATER 10% D2O	Resolution not provided
2CEZ Phosphorylation of the Cytoplasmic Tail of Tissue Factor and its Role in Modulating Structure and Binding Affinity Deposited 2006-02-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 277–295（19 aa） Fragment：TISSUE FACTOR CYTOPLASMIC DOMAIN, RESIDUES 277-295	Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6；285 K；Ionic strength (raw mmCIF value) 0；Pressure 1.0 NMR sample composition 90% WATER 10% D2O	Resolution not provided
2CFJ Phosphorylation of the Cytoplasmic Tail of Tissue Factor and its Role in Modulating Structure and Binding Affinity Deposited 2006-02-21	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Protein monomer Monomer；Protein × 1 PDB declaration: monomeric	Chain A 277–295（19 aa） Fragment：TISSUE FACTOR CYTOPLASMIC DOMAIN, RESIDUES 277-295	Non-standard monomer：Yes (specific site not provided by mmCIF)	No recorded non-water small molecule	SOLUTION NMR NMR measurement conditions pH 6；285 K；Ionic strength (raw mmCIF value) 0；Pressure 1.0 NMR sample composition 90% WATER 10% D2O	Resolution not provided
2EC9 Crystal structure analysis of human Factor VIIa , Souluble tissue factor complexed with BCX-3607 Deposited 2007-02-13	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain T 38–112（75 aa） Fragment：residues 38-112 Chain U 123–242（120 aa） Fragment：residues 91-210	Not recorded	ASO 1,5-anhydro-D-glucitol × 1 FUC alpha-L-fucopyranose × 1 CA CALCIUM ION × 9 24X 2'-((5-CARBAMIMIDOYLPYRIDIN-2-YLAMINO)METHYL)-4-(ISOBUTYLCARBAMOYL)-4'-VINYLBIPHENYL-2-CARBOXYLIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；14% (w/v)PEG 4K, 0.1M MgCl2, 0.1M ADA buffer, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K	Resolution 2.00 Å R-free 0.282
2F9B Discovery of Novel Heterocyclic Factor VIIa Inhibitors Deposited 2005-12-05	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain T 34–251（218 aa） Fragment：residues 34-251	Not recorded	N1H {5-(5-AMINO-1H-PYRROLO[3,2-B]PYRIDIN-2-YL)-6-HYDROXY-3'-NITRO-BIPHENYL-3-YL]-ACETIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.2；290 K；0.1 M CITRATE, 16-18% PEG5000 MME, pH 7.2, VAPOR DIFFUSION, HANGING DROP, temperature 290K	Resolution 2.54 Å R-free 0.286
2FIR Crystal structure of DFPR-VIIa/sTF Deposited 2005-12-30	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain T 38–242（205 aa）	Not recorded	GLC alpha-D-glucopyranose × 1 FUC alpha-L-fucopyranose × 1 MG MAGNESIUM ION × 3 CA CALCIUM ION × 6 0G7 D-phenylalanyl-N-[(3S)-6-carbamimidamido-1-chloro-2-oxohexan-3-yl]-L-prolinamide × 1 NA SODIUM ION × 1 ZN ZINC ION × 2 CL CHLORIDE ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 6.5；293 K；20% PEG 4000, 100 mM magnesium chloride, 200 mM sodium chloride, 10 mM calcium chloride, 20 uM zinc chloride , pH 6.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 2.00 Å R-free 0.281
2FLB Discovery of a Novel Hydroxy Pyrazole Based Factor IXa Inhibitor Deposited 2006-01-05	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain T 34–251（218 aa） Fragment：residues 34-251	Not recorded	6NH 2-(4-HYDROXY-5-PHENYL-1H-PYRAZOL-3-YL)-1H-BENZOIMIDAZOLE-5-CARBOXAMIDINE × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.2；290 K；0.1 M CITRATE, 16-18% PEG5000 MME, pH 7.2, VAPOR DIFFUSION, HANGING DROP, temperature 290.0K	Resolution 1.95 Å R-free 0.280
2FLR Novel 5-Azaindole Factor VIIa Inhibitors Deposited 2006-01-06	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain T 34–251（218 aa） Fragment：residues 34-251	Not recorded	7NH [2'-HYDROXY-3'-(1H-PYRROLO[3,2-C]PYRIDIN-2-YL)-BIPHENYL-3-YLMETHYL]-UREA × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.2；290 K；0.1 M CITRATE, 16-18% PEG5000 MME, pH 7.2, VAPOR DIFFUSION, HANGING DROP, temperature 290K	Resolution 2.35 Å R-free 0.259
2PUQ Crystal structure of active site inhibited coagulation factor VIIA in complex with soluble tissue factor Deposited 2007-05-09	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain T 38–241（204 aa）	Not recorded	BGC beta-D-glucopyranose × 1 FUC alpha-L-fucopyranose × 1 CA CALCIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.6；298 K；0.1 M sodium citrate, pH 5.6, 16.0 % (w/v) PEG 4000, 12 % (v/v) 1-propanol, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.05 Å R-free 0.273
2ZP0 Human factor viia-tissue factor complexed with benzylsulfonamide-D-ile-gln-P-aminobenzamidine Deposited 2008-06-20	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain T 33–250（218 aa） Fragment：RESIDUES 16-257	Not recorded	BGC beta-D-glucopyranose × 1 FUC alpha-L-fucopyranose × 1 CA CALCIUM ION × 9 PI0 (2S)-N-[(4-carbamimidoylphenyl)methyl]-2-[[(2R,3R)-3-methyl-2-(phenylmethylsulfonylamino)pentanoyl]amino]pentanediamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5；298 K；8 % PEG 5000, 0.1M sodium chloride, 0.005M calcium chloride, 0.1M cacodylate, pH 5.0, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.70 Å R-free 0.306
2ZWL Human factor viia-tissue factor complexed with highly selective peptide inhibitor Deposited 2008-12-16	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain T 33–250（218 aa） Fragment：UNP residues 33-250	Not recorded	BGC beta-D-glucopyranose × 1 FUC alpha-L-fucopyranose × 1 CA CALCIUM ION × 9 567 2-[[(2R)-1-[[(2S)-5-amino-1-[(4-carbamimidoylphenyl)methylamino]-1,5-dioxo-pentan-2-yl]amino]-3-(1H-indol-3-yl)-1-oxo-propan-2-yl]sulfamoyl]ethanoic acid × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5；298 K；8% PEG 5000, 0.1M sodium chloride, 0.005M calcium chloride, 0.1M cacodylate, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.20 Å R-free 0.267
2ZZU Human Factor VIIA-Tissue Factor Complexed with ethylsulfonamide-D-5-(3-carboxybenzyloxy)-Trp-Gln-p-aminobenzamidine Deposited 2009-02-25	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain T 33–250（218 aa） Fragment：UNP RESIDUES 33-250	Not recorded	BGC beta-D-glucopyranose × 1 FUC alpha-L-fucopyranose × 1 CA CALCIUM ION × 9 359 3-[[3-[(2R)-3-[[(2S)-5-amino-1-[(4-carbamimidoylphenyl)methylamino]-1,5-dioxo-pentan-2-yl]amino]-2-(ethylsulfonylamino)-3-oxo-propyl]-1H-indol-5-yl]oxymethyl]benzoic acid × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5；298 K；8% PEG5000, 0.1M sodium chloride, 0.005M calcium chloride, 0.1M cacodylate, VAPOR DIFFUSION, HANGING DROP, TEMPERATURE 298K	Resolution 2.50 Å R-free 0.273
3ELA Crystal structure of active site inhibited coagulation factor VIIA mutant in complex with soluble tissue factor Deposited 2008-09-21	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain T 33–241（209 aa） Fragment：UNP residues 33-241	Not recorded	GLC alpha-D-glucopyranose × 1 FUC alpha-L-fucopyranose × 1 CA CALCIUM ION × 1 0Z6 D-phenylalanyl-N-[(2S,3S)-6-{[amino(iminio)methyl]amino}-1-chloro-2-hydroxyhexan-3-yl]-L-phenylalaninamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.6；298 K；100mM NaCitrate, 16%(w/v) PEG4000, 12%(v/v) 1-propanol, pH 5.6, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 2.20 Å R-free 0.294
3TH2 Mg2+ Is Required for Optimal Folding of the Gamma-Carboxyglutamic Acid (Gla) Domains of Vitamin K-Dependent Clotting Factors At Physiological Ca2+ Deposited 2011-08-18	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain T 38–242（205 aa）	Not recorded	BGC beta-D-glucopyranose × 1 FUC alpha-L-fucopyranose × 1 MG MAGNESIUM ION × 3 CA CALCIUM ION × 6 BEN BENZAMIDINE × 1 NA SODIUM ION × 1 CL CHLORIDE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions pH 7；298 K；20% PEG 4000, 50 mM Tris-HCL, 50 mM N-(2-Acetamido)iminodiacetic acid, 150 mM NaCl, 5 mM Calcium Chloride, 2.5 mM Magnesium Chloride, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K	Resolution 1.72 Å R-free 0.233
3TH3 Mg2+ Is Required for Optimal Folding of the Gamma-Carboxyglutamic Acid (Gla) Domains of Vitamin K-Dependent Clotting Factors At Physiological Ca2+ Deposited 2011-08-18	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain T 38–242（205 aa）	Not recorded	FUC alpha-L-fucopyranose × 1 CA CALCIUM ION × 2 BGC beta-D-glucopyranose × 1 0GE N-{[5-(dimethylamino)naphthalen-1-yl]sulfonyl}-L-alpha-glutamyl-N-[(2S,3S)-6-carbamimidamido-1-chloro-2-hydroxyhexan-3-yl]glycinamide × 1 CL CHLORIDE ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7；298 K；20% PEG 4000, 50 mM Tris-HCL, 50 mM N-(2-Acetamido)iminodiacetic acid, 150 mM NaCl, 2.5 mM Calcium Chloride, 1.25 mM Magnesium Chloride, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 298.0K	Resolution 2.70 Å R-free 0.298
3TH4 Mg2+ Is Required for Optimal Folding of the Gamma-Carboxyglutamic Acid (Gla) Domains of Vitamin K-Dependent Clotting Factors At Physiological Ca2+ Deposited 2011-08-18	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain T 38–242（205 aa）	Not recorded	BGC beta-D-glucopyranose × 1 FUC alpha-L-fucopyranose × 1 MG MAGNESIUM ION × 2 CA CALCIUM ION × 7 0GE N-{[5-(dimethylamino)naphthalen-1-yl]sulfonyl}-L-alpha-glutamyl-N-[(2S,3S)-6-carbamimidamido-1-chloro-2-hydroxyhexan-3-yl]glycinamide × 1 CL CHLORIDE ION × 3 NA SODIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions pH 7；298 K；20% PEG 4000, 50 mM Tris-HCL, 50 mM N-(2-Acetamido)iminodiacetic acid, 150 mM NaCl, 45 mM Calcium Chloride, 5 mM Magnesium Chloride, pH 7.0, VAPOR DIFFUSION, temperature 298K	Resolution 1.80 Å R-free 0.235
4IBL Rubidium Sites in Blood Coagulation Factor VIIa Deposited 2012-12-08	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain T 33–251（219 aa）	Not recorded	BGC beta-D-glucopyranose × 1 FUC alpha-L-fucopyranose × 1 MG MAGNESIUM ION × 3 CA CALCIUM ION × 4 RB RUBIDIUM ION × 6 BEN BENZAMIDINE × 1 CL CHLORIDE ION × 4	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 7.5；298 K；20 mM Tris-HCL, 200mM RbCl, 5 mM Calcium Chloride, 45 mM Magnesium Chloride , pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 298K	Resolution 1.80 Å R-free 0.215
4M7L Crystal structure of the complex between human tissue factor extracellular domain and antibody 10H10 FAB fragment Deposited 2013-08-12	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain T 37–245（209 aa） Fragment：extracellular domain (UNP residues 37-245)	Not recorded	No recorded non-water small molecule	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 10.5；293 K；0.1 M CAPS, pH 10.5, 24% PEG8000, VAPOR DIFFUSION, SITTING DROP, temperature 293K	Resolution 3.40 Å R-free 0.289
4YLQ Crystal Structure of a FVIIa-Trypsin Chimera (FT) in Complex with Soluble Tissue Factor Deposited 2015-03-05	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain T 33–251（219 aa） Fragment：UNP residues 33-251	Not recorded	CA CALCIUM ION × 9 FUC alpha-L-fucopyranose × 1 TMA TETRAMETHYLAMMONIUM ION × 22 0Z7 N-acetyl-D-phenylalanyl-N-[(2S,3S)-6-carbamimidamido-1-chloro-2-hydroxyhexan-3-yl]-L-phenylalaninamide × 1 POL N-PROPANOL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.6；295 K；0.1M NaCitrate, 16.6% PEG 3350, 12.5% 1-Propanol, with seeding	Resolution 1.40 Å R-free 0.174
4Z6A Crystal Structure of a FVIIa-Trypsin Chimera (YT) in Complex with Soluble Tissue Factor Deposited 2015-04-04	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain T 36–242（207 aa） Fragment：unp residues 36-242	Not recorded	BGC beta-D-glucopyranose × 1 FUC alpha-L-fucopyranose × 1 0Z6 D-phenylalanyl-N-[(2S,3S)-6-{[amino(iminio)methyl]amino}-1-chloro-2-hydroxyhexan-3-yl]-L-phenylalaninamide × 1 CA CALCIUM ION × 1 CIT CITRIC ACID × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.6；295 K；0.1M NaCitrate, 16.6% PEG 3350, 12.5% 1-Propanol, with seeding	Resolution 2.25 Å R-free 0.240
4ZMA Crystal Structure of a FVIIa-Trypsin Chimera (ST) in Complex with Soluble Tissue Factor Deposited 2015-05-02	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain T 33–251（219 aa）	Not recorded	CA CALCIUM ION × 8 BGC beta-D-glucopyranose × 1 FUC alpha-L-fucopyranose × 1 0Z6 D-phenylalanyl-N-[(2S,3S)-6-{[amino(iminio)methyl]amino}-1-chloro-2-hydroxyhexan-3-yl]-L-phenylalaninamide × 1 CAC CACODYLATE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.1；295 K；0.1M Cacodylate,11% PEG 8000 , with seeding	Resolution 2.30 Å R-free 0.295
5W06 HUMAN TISSUE FACTOR IN COMPLEX WITH ANTIBODY M1587 Deposited 2017-05-30	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain T 37–245（209 aa） Fragment：EXTRACELLULAR DOMAIN (UNP residues 37-245)	Not recorded	GOL GLYCEROL × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 4.5；293 K；0.1 M SODIUM ACETATE PH 4.5, 18% PEG 3K, 0.2 M AMMONIUM ACETATE	Resolution 2.60 Å R-free 0.235
6R2W Crystal structure of the super-active FVIIa variant VYT in complex with tissue factor Deposited 2019-03-19	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Other combination Heteromer；Protein × 3 PDB declaration: trimeric	Chain T 33–242（210 aa）	Not recorded	CA CALCIUM ION × 9 FUC alpha-L-fucopyranose × 1 TMA TETRAMETHYLAMMONIUM ION × 10 0Z7 N-acetyl-D-phenylalanyl-N-[(2S,3S)-6-carbamimidamido-1-chloro-2-hydroxyhexan-3-yl]-L-phenylalaninamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 5.6；295 K；0.1 M sodium citrate, pH 5.6, 15.6 % (w/v) PEG 3350, 12 % (v/v) 1-Propanol	Resolution 1.25 Å R-free 0.194
8CN9 Factor VII binding Fab of the bispecific antibody HMB-001 in complex with Factor VII Deposited 2023-02-22	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain E 33–251（219 aa）	Not recorded	CA CALCIUM ION × 2 BGC beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.3；293 K；0.15 M Cesium chloride 15% w/v Polyethylene glycol 3,350	Resolution 3.40 Å R-free 0.356
8CN9 Factor VII binding Fab of the bispecific antibody HMB-001 in complex with Factor VII Deposited 2023-02-22	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 2 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain J 33–251（219 aa）	Not recorded	CA CALCIUM ION × 3 BGC beta-D-glucopyranose × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.3；293 K；0.15 M Cesium chloride 15% w/v Polyethylene glycol 3,350	Resolution 3.40 Å R-free 0.356
8CN9 Factor VII binding Fab of the bispecific antibody HMB-001 in complex with Factor VII Deposited 2023-02-22	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 3 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain O 33–251（219 aa）	Not recorded	CA CALCIUM ION × 3	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.3；293 K；0.15 M Cesium chloride 15% w/v Polyethylene glycol 3,350	Resolution 3.40 Å R-free 0.356
8CN9 Factor VII binding Fab of the bispecific antibody HMB-001 in complex with Factor VII Deposited 2023-02-22	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 4 Protein heterocomplex Heteromer；Protein × 5 PDB declaration: pentameric	Chain T 33–251（219 aa）	Not recorded	CA CALCIUM ION × 2 BGC beta-D-glucopyranose × 1 CS CESIUM ION × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, SITTING DROP；pH 7.3；293 K；0.15 M Cesium chloride 15% w/v Polyethylene glycol 3,350	Resolution 3.40 Å R-free 0.356
8QOD CRYSTAL STRUCTURE OF FVIIA IN COMPLEX WITH A BENZAMIDINE-BASED INHIBITOR Deposited 2023-09-28	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 1–243（243 aa）	Not recorded	CA CALCIUM ION × 4 MG MAGNESIUM ION × 1 GLC alpha-D-glucopyranose × 1 FUC alpha-L-fucopyranose × 1 WIZ 3-[2-bromanyl-4-[(1~{S})-1-[[3-[(4-carbamimidoylphenyl)amino]-3-oxidanylidene-propanoyl]amino]ethyl]phenoxy]benzoic acid × 1 CL CHLORIDE ION × 2	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；The VIIa/sTF complex was crystallized using the sitting drop or the hanging drop vapor diffusion method. Specifically, the protein drop contained 4 mg/ml VIIa/sTF complex, 20 mm Tris-HCl, pH 7.5, 200 mm NaCl, 10 mm CaCl2, and 10 mm pAB or 10 mm benzamidine, whereas the reservoir solution contained 16-22% PEG 4000, 100 mm MgCl2, and 20 mm BisTris, pH 6.5. Drops were prepared by mixing 2 ul of protein solution with 2 ul of reservoir solution at 20 C. Crystals appeared within 7 days and were allowed to grow up to 14-20 days before being flash-frozen without additional cryoprotectant.	Resolution 1.57 Å R-free 0.214
8QQ6 CRYSTAL STRUCTURE OF FVIIA IN COMPLEX WITH A BENZAMIDINE-BASED INHIBITOR Deposited 2023-10-03	Different construct Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 3 PDB declaration: trimeric	Chain C 1–243（243 aa）	Not recorded	CA CALCIUM ION × 2 MG MAGNESIUM ION × 1 GLC alpha-D-glucopyranose × 1 FUC alpha-L-fucopyranose × 1 CL CHLORIDE ION × 2 WSV 2-azanyl-~{N}-[[2-[2-[[3-methoxy-4-(1,3-oxazol-5-yl)phenyl]amino]-1,3-oxazol-5-yl]phenyl]methyl]-~{N}-methyl-ethanamide × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；The VIIa/sTF complex was crystallized using the sitting drop or the hanging drop vapor diffusion method. Specifically, the protein drop contained 4 mg/ml VIIa/sTF complex, 20 mm Tris-HCl, pH 7.5, 200 mm NaCl, 10 mm CaCl2, and 10 mm pAB or 10 mm benzamidine, whereas the reservoir solution contained 16-22% PEG 4000, 100 mm MgCl2, and 20 mm BisTris, pH 6.5. Drops were prepared by mixing 2 ul of protein solution with 2 ul of reservoir solution at 20 C. Crystals appeared within 7 days and were allowed to grow up to 14-20 days before being flash-frozen without additional cryoprotectant.	Resolution 1.87 Å R-free 0.259
8UUD BCX2627 complexed with human FVIIa and soluble Tissue Factor. Deposited 2023-11-01	Different construct Different mutation/modification Different oligomeric state Different ligand/ion Different experimental conditions Different structure-quality metrics	Assembly 1 Protein heterocomplex Heteromer；Protein × 4 PDB declaration: tetrameric	Chain T 38–112（75 aa） Chain U 123–242（120 aa）	Not recorded	BGC beta-D-glucopyranose × 1 FUC alpha-L-fucopyranose × 1 CA CALCIUM ION × 9 XGX (1P)-2'-[(4-carbamimidoylphenyl)carbamoyl]-4'-ethenyl-4-[(2-methylpropyl)carbamoyl][1,1'-biphenyl]-2-carboxylic acid × 1	X-RAY DIFFRACTION X-ray crystallization conditions VAPOR DIFFUSION, HANGING DROP；pH 6.5；293 K；14% (w/v)PEG 4K, 0.1M MgCl2, 0.1M ADA buffer, pH 6.5, VAPOR DIFFUSION,	Resolution 2.40 Å R-free 0.265
9P0X Nanodisc-embedded human TF/FVIIa/XK1 in complex with 10H10 Fab (nanodisc-subtracted) Deposited 2025-06-07	Different construct Different oligomeric state Different ligand/ion Different experimental method Different experimental conditions Different structure-quality metrics	Assembly 1 Insufficient information Heteromer；Protein × 7 PDB declaration: heptameric	Chain T 38–276（239 aa）	Not recorded	MG MAGNESIUM ION × 4 CA CALCIUM ION × 12 BGC beta-D-glucopyranose × 1 FUC alpha-L-fucopyranose × 1	ELECTRON MICROSCOPY cryo-EM buffer pH 7.4 cryo-EM vitrification conditions Cryogen ETHANE	Resolution 3.70 Å

52 other PDB entries and 56 assemblies. Open the comparison page and filter oligomeric states

View Construct and Data Evidence

UniProt name	TF_HUMAN
Isoform	—
PDB entities	1
Chains and sequence ranges	Author chain A； PDBConstruct 1–218； UniProt 33–243

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

SAXS scattering curve SAXS Profile

P(r) Distance Distribution P(r) Distribution

Download Download SAXS (.dat) P(r) (.pr.out) CIF

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2hft
Deposition date deposition_date	1995-09-08
Structure title title	THE CRYSTAL STRUCTURE OF THE EXTRACELLULAR DOMAIN OF HUMAN TISSUE FACTOR AT 1.7 ANGSTROMS RESOLUTION
Keywords keywords	COAGULATION FACTOR; COAGULATION FACTOR
Experimental Method method	X-RAY DIFFRACTION

▼

3. SAXS Parameters (CRYSOL theoretical calculation) 3. SAXS Parameters (CRYSOL)

Radius of gyration Rg (Guinier) rg_guinier	23.33 Å
Radius of gyration Rg (electron density) rg_electron	22.82 Å
Forward intensity I(0) i0	9997120.00
Molecular weight molecular_weight	23427.0 kDa
Excluded volume excluded_volume	29244 Å³
Envelope volume envelope_volume	36136 Å³
Hydration-shell volume shell_volume	14992 Å³
Envelope diameter envelope_diameter	92.1 Å
Shell Rg shell_rg	26.98 Å
Envelope Rg envelope_rg	23.29 Å
Shape Rg shape_rg	22.78 Å
Total Rg total_rg	23.54 Å
Total atoms total_atoms	1650
Residues n_residues	205
Spherical-harmonic order n_harmonics	20
q range q_range	— – 0.5000 Å⁻¹
Data points n_points	101
Shell type shell_type	directional
Solvent electron density solvent_density	0.3340 e/Å³
Shell contrast contrast_shell	0.0300 e/Å³
CRYSOL version crysol_version	4.1.3

▼

4. P(r) Distance Distribution (GNOM inversion) 4. P(r) Analysis (GNOM)

Maximum dimension Dmax dmax	88.0 Å
Rg (real space) rg_real	23.69 Å
Rg uncertainty (real space) rg_real_error	1.09 Å
I(0) (real space) i0_real	9.9970e+06
I(0) uncertainty (real space) i0_real_error	1.6930e+05
Rg (reciprocal space) rg_reciprocal	23.61 Å
I(0) (reciprocal space) i0_reciprocal	9997000.0000
Solution quality estimate total_estimate	0.7311
Solution quality rating solution_quality	REASONABLE a REASONABLE solution
P(r) peaks n_peaks	2
Primary peak position r_peak_primary	19.0 Å
Skewness Skewness skewness	0.638
Kurtosis Kurtosis kurtosis	-0.164
Angular range angular_range	— – 0.3400 Å⁻¹
Current regularization parameter α current_alpha	0.0000
Highest regularization parameter α highest_alpha	3743000.0000
Real-space data points n_real_points	66
GNOM version gnom_version	4.1.3
Quality Criteria quality_criteria	AN1: 0.000; Oscil: 0.430; Stabil: 0.997; Sysdev: 1.000; Positv: 1.000; Valcen: 0.226; Smooth: 0.992

▶

5. Crystallography and Experiment 5. Crystallography & Experiment

▶

6. Entities and Polymers Entities & Polymers (3)

Entity 1 Entity 1 polymer

Description description	HUMAN TISSUE FACTOR
Molecular weight formula_weight	24697.4 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A
Atom count atom_count	1936

SGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSQEKGEFRSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMG

来源 Source

来源生物 organism	Homo sapiens
通用名 common_name	human
NCBI Class编号 ncbi_taxonomy_id	9606
宿主生物 host_organism	Escherichia coli

Entity 2 Entity 2 non-polymer

Description description	SULFATE ION
Molecular weight formula_weight	96.1 kDa
Source method src_method	syn
Copy count entity_count	1

Entity 3 Entity 3 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	235

▼

7. Fold Classification (SCOP + CATH) 4 domains

SCOP 2.08 (2 domains)

Domain ID domain_id	d2hfta1
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.2 — Fibronectin type III
Family Family family	b.1.2.1 — Fibronectin type III

Domain ID domain_id	d2hfta2
Class class	b — All beta proteins
Fold Fold fold	b.1 — Immunoglobulin-like beta-sandwich
Superfamily Superfamily superfamily	b.1.2 — Fibronectin type III
Family Family family	b.1.2.1 — Fibronectin type III

CATH v4.4 (2 domains)

Domain ID domain_id	2hftA01
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

Domain ID domain_id	2hftA02
Class class	2 — Mainly Beta
Architecture architecture	60 — Sandwich
Topology topology	40 — Immunoglobulin-like
Homologous superfamily homologous superfamily	10 — Immunoglobulins

▶

8. Citations (3)

▶

Unit-cell length a length_a	45.200 Å
Unit-cell length b length_b	45.200 Å
Unit-cell length c length_c	230.800 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	8

Space group space_group	P 41 21 2
Space-group number int_tables_number	92
Crystal system crystal_system	—

Resolution resolution	1.690 Å
Low-resolution limit resolution_low	6.000 Å
R factor r_factor	0.2040
R_work r_work	—
R_free r_free	0.2540

fit	/app/data/saxs_computation/hf/2hft/2hft.fit
pddf	/app/data/pr_computation/hf/2hft/2hft.pr.out
profile	/app/data/saxs_computation/hf/2hft/2hft.dat