SAXSdb — 2iie

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Integration host factor

Escherichia coli

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Monomer	Protein 1 DNA 3	;Phage P H' site ; × 1 ;DNA (5'-D(DGPDGPDCPDCPDAPDAPDAPDAPDAPDAPDGPDCPDAPDTPDT)-3') ; × 1 ;DNA (5'-D(DGPDCPDTPDTPDAPDTPDCPDAPDAPDTPDTPDTPDGPDTPDTPDGPDCPDAPDCP*DC)-3') ; × 1 MANGANESE (II) ION × 7 water × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	IHFA_ECOLI
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain A； PDBConstruct 47–138； UniProt 3–94

Integration host factor

Escherichia coli

UniProt P0A6Y1

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Insufficient information	Monomer	Protein 1 DNA 3	;Phage P H' site ; × 1 ;DNA (5'-D(DGPDGPDCPDCPDAPDAPDAPDAPDAPDAPDGPDCPDAPDTPDT)-3') ; × 1 ;DNA (5'-D(DGPDCPDTPDTPDAPDTPDCPDAPDAPDTPDTPDTPDGPDTPDTPDGPDCPDAPDCP*DC)-3') ; × 1 MANGANESE (II) ION × 7 water × 4	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	IHFB_ECOLI
Isoform	—
PDB entities	4
Chains and sequence ranges	Author chain A； PDBConstruct 4–41； UniProt 2–39 Author chain A； PDBConstruct 141–195； UniProt 40–94

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2iie
Deposition date deposition_date	2006-09-28
Structure title title	single chain Integration Host Factor protein (scIHF2) in complex with DNA
Keywords keywords	DNA kinking, bending, U-turn, intercalation, divalent, RECOMBINATION-DNA COMPLEX; RECOMBINATION/DNA
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2iie__assembly_1__model_1

Assembly 1 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2iie__assembly_1__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2iie__assembly_1__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	23.81 Å
Rg (electron density)	22.38 Å
Total Rg	23.16 Å
Atom count	3043
Residues	274
Excluded volume	49399 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2iie__assembly_1__model_1`	tetrameric （4）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Description description	;Phage P H' site ;
Molecular weight formula_weight	10802.0 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	C
Atom count atom_count	3318

CGGTGCAACAAATTGATAAGCAATGCTTTTTTGGC

Entity 2 Entity 2 polymer

Description description	;DNA (5'-D(DGPDGPDCPDCPDAPDAPDAPDAPDAPDAPDGPDCPDAPDTP*DT)-3') ;
Molecular weight formula_weight	4611.0 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	D

GGCCAAAAAAGCATT

Entity 3 Entity 3 polymer

Description description	;DNA (5'-D(DGPDCPDTPDTPDAPDTPDCPDAPDAPDTPDTPDTPDGPDTPDTPDGPDCPDAPDCPDC)-3') ;
Molecular weight formula_weight	6074.9 kDa
Source method src_method	syn
Copy count entity_count	1

Polymer Polymer

Polymer type type	polydeoxyribonucleotide
Chain IDs strand_id	E

GCTTATCAATTTGTTGCACC

Entity 4 Entity 4 polymer

Description description	Integration host factor
Molecular weight formula_weight	22884.9 kDa
Source method src_method	man
Copy count entity_count	1

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A

MASTKSELIERLATQQSHIPAKTVEDAVKEMLEHMASTLAQGGSGGLTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGNFDLRDKNQRPGRNPKTGEDIPITARRVVTFRPGQKLKSRVENAGGGERIEIRGFGSFSLHYRAPRTGRNPKTGDKVELEGKYVPHFKPGKELRDRANIYGGSGHHHHHH

Source Source

Source organism organism	Escherichia coli
NCBI taxonomy ID ncbi_taxonomy_id	562
Host organism host_organism	Escherichia coli

Entity 5 Entity 5 non-polymer

Description description	MANGANESE (II) ION
Molecular weight formula_weight	54.9 kDa
Source method src_method	syn
Copy count entity_count	7

Entity 6 Entity 6 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	275

▼

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

Domain ID domain_id	2iieA01
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	520 — HU Protein; Chain A
Homologous superfamily homologous superfamily	10 — IHF-like DNA-binding proteins

Domain ID domain_id	2iieA02
Class class	4 — Few Secondary Structures
Architecture architecture	10 — Irregular
Topology topology	520 — HU Protein; Chain A
Homologous superfamily homologous superfamily	10 — IHF-like DNA-binding proteins

▶

Unit-cell length a length_a	47.371 Å
Unit-cell length b length_b	55.311 Å
Unit-cell length c length_c	177.833 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	90.00 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	4

Space group space_group	P 21 21 21
Space-group number int_tables_number	19
Crystal system crystal_system	—

Resolution resolution	2.410 Å
Low-resolution limit resolution_low	40.000 Å
R factor r_factor	0.2340
R_work r_work	0.2330
R_free r_free	0.2720

single chain Integration Host Factor protein (scIHF2) in complex with DNA

1. Protein Identity and Related Structures Protein Identity & Related Structures

Integration host factor

State in the Current Structure

Other States of the Same Protein in the Database

Integration host factor

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2iie__assembly_1__model_1

2iie__assembly_1__model_1 | I(q)

2iie__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

7. Citations (3)

single chain Integration Host Factor protein (scIHF2) in complex with DNA

1. Protein Identity and Related Structures Protein Identity & Related Structures

Integration host factor

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

Integration host factor

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2iie__assembly_1__model_1

2iie__assembly_1__model_1 | I(q)

2iie__assembly_1__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (6)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Entity 3 Entity 3 polymer

Polymer Polymer

Entity 4 Entity 4 polymer

Polymer Polymer

Source Source

Entity 5 Entity 5 non-polymer

Entity 6 Entity 6 water

6. Fold Classification (SCOP + CATH) 2 domains

CATH v4.4 (2 domains)

7. Citations (3)