2qux

PP7 coat protein dimer in complex with RNA hairpin

Method: X-RAY DIFFRACTION

▼

1. Protein Identity and Related Structures Protein Identity & Related Structures

Coat protein

Pseudomonas phage PP7

State in the Current Structure

Assembly	Physical composition	Protein state	Molecular copy count	Associated components	Data consistency
1	Protein–RNA	Homooligomer	Protein 2 RNA 1	RNA (25-MER) × 1 GLYCEROL × 4 water × 3	Consistent with all polymers
2	Protein–RNA	Homooligomer	Protein 2 RNA 1	RNA (25-MER) × 1 GLYCEROL × 3 water × 3	Consistent with all polymers
3	Protein–RNA	Homooligomer	Protein 2 RNA 1	RNA (25-MER) × 1 GLYCEROL × 3 water × 3	Consistent with all polymers
4	Protein–RNA	Homooligomer	Protein 2 RNA 1	RNA (25-MER) × 1 GLYCEROL × 4 water × 3	Consistent with all polymers
5	Protein–RNA	Homooligomer	Protein 2 RNA 1	RNA (25-MER) × 1 water × 3	Consistent with all polymers
6	Protein–RNA	Homooligomer	Protein 2 RNA 1	RNA (25-MER) × 1 GLYCEROL × 1 water × 2	Consistent with all polymers

Other States of the Same Protein in the Database

View Construct and Data Evidence

UniProt name	Q38062_BPPP7
Isoform	—
PDB entities	2
Chains and sequence ranges	Author chain A； PDBConstruct 4–70； UniProt 1–67 Author chain A； PDBConstruct 73–125； UniProt 76–128 Author chain B； PDBConstruct 4–70； UniProt 1–67 Author chain B； PDBConstruct 73–125； UniProt 76–128 Author chain D； PDBConstruct 4–70； UniProt 1–67 Author chain D； PDBConstruct 73–125； UniProt 76–128 Author chain E； PDBConstruct 4–70； UniProt 1–67 Author chain E； PDBConstruct 73–125； UniProt 76–128 Author chain G； PDBConstruct 4–70； UniProt 1–67 Author chain G； PDBConstruct 73–125； UniProt 76–128 Author chain H； PDBConstruct 4–70； UniProt 1–67 Author chain H； PDBConstruct 73–125； UniProt 76–128 Author chain J； PDBConstruct 4–70； UniProt 1–67 Author chain J； PDBConstruct 73–125； UniProt 76–128 Author chain K； PDBConstruct 4–70； UniProt 1–67 Author chain K； PDBConstruct 73–125； UniProt 76–128 Author chain M； PDBConstruct 4–70； UniProt 1–67 Author chain M； PDBConstruct 73–125； UniProt 76–128 Author chain N； PDBConstruct 4–70； UniProt 1–67 Author chain N； PDBConstruct 73–125； UniProt 76–128 Author chain P； PDBConstruct 4–70； UniProt 1–67 Author chain P； PDBConstruct 73–125； UniProt 76–128 Author chain Q； PDBConstruct 4–70； UniProt 1–67 Author chain Q； PDBConstruct 73–125； UniProt 76–128

The page prioritizes protein identity, the current assembly, associated components, oligomeric state and cross-PDB links. Chain mapping and sequence ranges are retained as data evidence. Internal IDs, import timestamps and assembly operation expressions are maintenance fields and are not shown here.

▼

2. Structure Basics 2. Structure Basics

Entry ID entry_id	2qux
Deposition date deposition_date	2007-08-06
Structure title title	PP7 coat protein dimer in complex with RNA hairpin
Keywords keywords	Bacteriophage coat protein, RNA-protein complex, Capsid protein, Structural PROTEIN-RNA COMPLEX; Structural PROTEIN/RNA
Experimental Method method	X-RAY DIFFRACTION

▼

3. Official assembly/model SAXS Official SAXS Profiles

This page reads only the latest assembly calculations. Every curve maps to an explicit PDB entry, official biological assembly and coordinate model.

2qux__assembly_3__model_1

Assembly 3 · Model 1 · CRYSOL 4.1.3-1-20251215 (887e7ef)

Download this curve (.dat)

2qux__assembly_3__model_1 | I(q)

100 plotted points; both axes use logarithmic scales.

2qux__assembly_3__model_1 | P(r) · Pending

P(r) will be calculated and displayed separately for the same assembly/model.

Rg（Guinier）	20.87 Å
Rg (electron density)	19.90 Å
Total Rg	20.85 Å
Atom count	2420
Residues	267
Excluded volume	41342 Å³
Maximum q	0.500 Å⁻¹

Assembly	Model	Structure unit	Oligomeric description	Status	CRYSOL	Actions
1	1	`2qux__assembly_1__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
2	1	`2qux__assembly_2__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
3	1	`2qux__assembly_3__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
4	1	`2qux__assembly_4__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
5	1	`2qux__assembly_5__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download
6	1	`2qux__assembly_6__model_1`	trimeric （3）	Success	4.1.3-1-20251215 (887e7ef)	View Download

▶

4. Crystallography and Experiment 4. Crystallography & Experiment

▶

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Description description	RNA (25-MER)
Molecular weight formula_weight	8053.8 kDa
Source method src_method	syn
Copy count entity_count	6

Polymer Polymer

Polymer type type	polyribonucleotide
Chain IDs strand_id	C,F,I,L,O,R
Atom count atom_count	15026

GGCACAGAAGAUAUGGCUUCGUGCC

Entity 2 Entity 2 polymer

Description description	Coat protein
Molecular weight formula_weight	13616.5 kDa
Source method src_method	man
Copy count entity_count	12

Polymer Polymer

Polymer type type	polypeptide(L)
Chain IDs strand_id	A,B,D,E,G,H,J,K,M,N,P,Q

GGSMSKTIVLSVGEATRTLTEIQSTADRQIFEEKVGPLVGRLRLTASLRQNGAKTAYRVNLKLDQADVVDSGLPKVRYTQVWSHDVTIVANSTEASRKSLYDLTKSLVATSQVEDLVVNLVPLGR

Source Source

Source organism organism	Pseudomonas phage PP7
NCBI taxonomy ID ncbi_taxonomy_id	12023
Host organism host_organism	Escherichia coli BL21(DE3)

Entity 3 Entity 3 non-polymer

Description description	GLYCEROL
Molecular weight formula_weight	92.1 kDa
Source method src_method	syn
Copy count entity_count	15

Entity 4 Entity 4 water

Description description	water
Molecular weight formula_weight	18.0 kDa
Source method src_method	nat
Copy count entity_count	512

▼

6. Fold Classification (SCOP + CATH) 28 domains

SCOP 2.08 (16 domains)

Domain ID domain_id	d2quxa1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.85 — RNA bacteriophage capsid protein
Superfamily Superfamily superfamily	d.85.1 — RNA bacteriophage capsid protein
Family Family family	d.85.1.1 — RNA bacteriophage capsid protein

Domain ID domain_id	d2quxa2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d2quxb_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.85 — RNA bacteriophage capsid protein
Superfamily Superfamily superfamily	d.85.1 — RNA bacteriophage capsid protein
Family Family family	d.85.1.1 — RNA bacteriophage capsid protein

Domain ID domain_id	d2quxd_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.85 — RNA bacteriophage capsid protein
Superfamily Superfamily superfamily	d.85.1 — RNA bacteriophage capsid protein
Family Family family	d.85.1.1 — RNA bacteriophage capsid protein

Domain ID domain_id	d2quxe_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.85 — RNA bacteriophage capsid protein
Superfamily Superfamily superfamily	d.85.1 — RNA bacteriophage capsid protein
Family Family family	d.85.1.1 — RNA bacteriophage capsid protein

Domain ID domain_id	d2quxg1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.85 — RNA bacteriophage capsid protein
Superfamily Superfamily superfamily	d.85.1 — RNA bacteriophage capsid protein
Family Family family	d.85.1.1 — RNA bacteriophage capsid protein

Domain ID domain_id	d2quxg2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d2quxh_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.85 — RNA bacteriophage capsid protein
Superfamily Superfamily superfamily	d.85.1 — RNA bacteriophage capsid protein
Family Family family	d.85.1.1 — RNA bacteriophage capsid protein

Domain ID domain_id	d2quxj1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.85 — RNA bacteriophage capsid protein
Superfamily Superfamily superfamily	d.85.1 — RNA bacteriophage capsid protein
Family Family family	d.85.1.1 — RNA bacteriophage capsid protein

Domain ID domain_id	d2quxj2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d2quxk1
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.85 — RNA bacteriophage capsid protein
Superfamily Superfamily superfamily	d.85.1 — RNA bacteriophage capsid protein
Family Family family	d.85.1.1 — RNA bacteriophage capsid protein

Domain ID domain_id	d2quxk2
Class class	l — Artifacts
Fold Fold fold	l.1 — Tags
Superfamily Superfamily superfamily	l.1.1 — Tags
Family Family family	l.1.1.1 — Tags

Domain ID domain_id	d2quxm_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.85 — RNA bacteriophage capsid protein
Superfamily Superfamily superfamily	d.85.1 — RNA bacteriophage capsid protein
Family Family family	d.85.1.1 — RNA bacteriophage capsid protein

Domain ID domain_id	d2quxn_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.85 — RNA bacteriophage capsid protein
Superfamily Superfamily superfamily	d.85.1 — RNA bacteriophage capsid protein
Family Family family	d.85.1.1 — RNA bacteriophage capsid protein

Domain ID domain_id	d2quxp_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.85 — RNA bacteriophage capsid protein
Superfamily Superfamily superfamily	d.85.1 — RNA bacteriophage capsid protein
Family Family family	d.85.1.1 — RNA bacteriophage capsid protein

Domain ID domain_id	d2quxq_
Class class	d — Alpha and beta proteins (a+b)
Fold Fold fold	d.85 — RNA bacteriophage capsid protein
Superfamily Superfamily superfamily	d.85.1 — RNA bacteriophage capsid protein
Family Family family	d.85.1.1 — RNA bacteriophage capsid protein

CATH v4.4 (12 domains)

Domain ID domain_id	2quxA00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	380 — MS2 Viral Coat Protein
Homologous superfamily homologous superfamily	10 — MS2 Viral Coat Protein

Domain ID domain_id	2quxB00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	380 — MS2 Viral Coat Protein
Homologous superfamily homologous superfamily	10 — MS2 Viral Coat Protein

Domain ID domain_id	2quxD00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	380 — MS2 Viral Coat Protein
Homologous superfamily homologous superfamily	10 — MS2 Viral Coat Protein

Domain ID domain_id	2quxE00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	380 — MS2 Viral Coat Protein
Homologous superfamily homologous superfamily	10 — MS2 Viral Coat Protein

Domain ID domain_id	2quxG00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	380 — MS2 Viral Coat Protein
Homologous superfamily homologous superfamily	10 — MS2 Viral Coat Protein

Domain ID domain_id	2quxH00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	380 — MS2 Viral Coat Protein
Homologous superfamily homologous superfamily	10 — MS2 Viral Coat Protein

Domain ID domain_id	2quxJ00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	380 — MS2 Viral Coat Protein
Homologous superfamily homologous superfamily	10 — MS2 Viral Coat Protein

Domain ID domain_id	2quxK00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	380 — MS2 Viral Coat Protein
Homologous superfamily homologous superfamily	10 — MS2 Viral Coat Protein

Domain ID domain_id	2quxM00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	380 — MS2 Viral Coat Protein
Homologous superfamily homologous superfamily	10 — MS2 Viral Coat Protein

Domain ID domain_id	2quxN00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	380 — MS2 Viral Coat Protein
Homologous superfamily homologous superfamily	10 — MS2 Viral Coat Protein

Domain ID domain_id	2quxP00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	380 — MS2 Viral Coat Protein
Homologous superfamily homologous superfamily	10 — MS2 Viral Coat Protein

Domain ID domain_id	2quxQ00
Class class	3 — Alpha Beta
Architecture architecture	30 — 2-Layer Sandwich
Topology topology	380 — MS2 Viral Coat Protein
Homologous superfamily homologous superfamily	10 — MS2 Viral Coat Protein

▶

Unit-cell length a length_a	174.970 Å
Unit-cell length b length_b	145.388 Å
Unit-cell length c length_c	109.655 Å
Unit-cell angle α angle_alpha	90.00 °
Unit-cell angle β angle_beta	122.94 °
Unit-cell angle γ angle_gamma	90.00 °
Molecules per unit cell Z z_pdb	48

Space group space_group	C 1 2 1
Space-group number int_tables_number	5
Crystal system crystal_system	—

Resolution resolution	2.440 Å
Low-resolution limit resolution_low	33.800 Å
R factor r_factor	0.1770
R_work r_work	0.1750
R_free r_free	0.2360

PP7 coat protein dimer in complex with RNA hairpin

1. Protein Identity and Related Structures Protein Identity & Related Structures

Coat protein

State in the Current Structure

Other States of the Same Protein in the Database

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2qux__assembly_3__model_1

2qux__assembly_3__model_1 | I(q)

2qux__assembly_3__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 28 domains

SCOP 2.08 (16 domains)

CATH v4.4 (12 domains)

7. Citations (1)

PP7 coat protein dimer in complex with RNA hairpin

1. Protein Identity and Related Structures Protein Identity & Related Structures

Coat protein

State in the Current Structure

Other States of the Same Protein in the Database

Monomer

Homodimer

Homotetramer

Other homooligomers

Heteromeric or nucleic-acid complex

2. Structure Basics 2. Structure Basics

3. Official assembly/model SAXS Official SAXS Profiles

2qux__assembly_3__model_1

2qux__assembly_3__model_1 | I(q)

2qux__assembly_3__model_1 | P(r) · Pending

4. Crystallography and Experiment 4. Crystallography & Experiment

Unit cell Unit Cell

Symmetry Symmetry

Refinement Refinement

Diffraction experiment Diffraction

5. Entities and Polymers Entities & Polymers (4)

Entity 1 Entity 1 polymer

Polymer Polymer

Entity 2 Entity 2 polymer

Polymer Polymer

Source Source

Entity 3 Entity 3 non-polymer

Entity 4 Entity 4 water

6. Fold Classification (SCOP + CATH) 28 domains

SCOP 2.08 (16 domains)

CATH v4.4 (12 domains)

7. Citations (1)